DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CycB

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster


Alignment Length:255 Identity:63/255 - (24%)
Similarity:114/255 - (44%) Gaps:50/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 TTTADPPATDNVNT----AIGDPTLYSDRCLENFLKVEEKHHKIPDTYFSI-------------Q 174
            |||:..|.|.::::    .|.|... :|:  ||.:.|.|..:.|.|..:.:             |
  Fly   221 TTTSTMPTTMSLSSKRLAGIEDIDA-NDK--ENLVLVSEYVNDIYDYLYQVELEQPIHKDHLAGQ 282

  Fly   175 KDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLS-SKSVRKTQLQILAAACLLLASKL 238
            |:::..||.::.:|:.||..:.:...|...||:..:||:|. .|..::|.||::....|.:|:|.
  Fly   283 KEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKY 347

  Fly   239 RE--PSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKN 301
            .|  |.    ::...|..||::.....:.:.||.:...:..:||...|:.||.            
  Fly   348 EELFPP----AIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLR------------ 396

  Fly   302 FPDINIGKVRG-----HAQA--FISLAAKEHKFAKFSASTIAASSIAASMNGLKWHLRSG 354
                ...|..|     |..:  ||.||:.:::.|.:..|.|||:|:..|::.|..:.|:|
  Fly   397 ----RYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEIAAASLFLSLHLLNGNHRAG 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 32/140 (23%)
Cyclin_C 282..>392 CDD:281044 20/80 (25%)
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 29/130 (22%)
Cyclin_C 389..515 CDD:281044 20/80 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.