DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccne2

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001102126.1 Gene:Ccne2 / 362485 RGDID:1307783 Length:405 Species:Rattus norvegicus


Alignment Length:311 Identity:76/311 - (24%)
Similarity:128/311 - (41%) Gaps:60/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PPPPPPPTATQSIQSYPRYISQE--------------------PPT-----SHCQRLD--ERLTT 128
            |..|..|...|.||:..|..:|:                    ||.     |.|..::  .:...
  Rat    17 PNQPDSPQEAQIIQAKKRKTAQDVKKRTEEITKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIG 81

  Fly   129 TADPPATDNV---NTAIGDPTL------YSDRCLENFLKVEEKHHKIPDTYFSI-QKDITPPMRK 183
            |:|.....|.   |..|....|      .|....:|.|:.|.::  :.|.:|.: ..|:.|.||.
  Rat    82 TSDFSRFTNYRFKNLFINPSPLPDLSWACSQEVWQNMLQKESRY--VHDKHFEVLHSDLEPQMRS 144

  Fly   184 IVAEWMMEVCAEENCQEEVVLLALNYMDRF-LSSKSVRKTQLQILAAACLLLASKLREPSCRALS 247
            |:.:|::|||.......|...||.::.||| |:.|.|.|..||::....|.:||||.|  ..|..
  Rat   145 ILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKLEE--IYAPK 207

  Fly   248 VDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRG 312
            :......||.:..:.|::|.||.:|..|.|:|..||.:.:|.|.:....:  |:.|.:.:.:.  
  Rat   208 LQEFAYVTDGACSEVDILKMELNILKALKWELCPVTVISWLNLFLQVDAV--KDIPKVLLPQY-- 268

  Fly   313 HAQAFISLA-----------AKEHKFAKFSASTI---AASSIAASMNGLKW 349
            ..:.||.:|           :.|.::...:|:.:   .:..:....:||:|
  Rat   269 SQETFIQIAQLLDLCILAIDSLEFQYRILAAAALCHFTSIEVVKKASGLEW 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 42/126 (33%)
Cyclin_C 282..>392 CDD:281044 14/82 (17%)
Ccne2NP_001102126.1 CYCLIN_SF 101..237 CDD:424085 43/139 (31%)
CYCLIN_SF 241..329 CDD:424085 14/83 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.