DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccnjl

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001032862.2 Gene:Ccnjl / 303059 RGDID:1561384 Length:387 Species:Rattus norvegicus


Alignment Length:306 Identity:68/306 - (22%)
Similarity:122/306 - (39%) Gaps:71/306 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LALNYMDRFLSSKSVRKT-QLQILAAACLLLASKLREPSCRALSVDLL----VVYTDN-SIYKDD 263
            ||:..:|.|:...:|..: ||..:|.:|||||||..:...|...:|.:    ::.:.| |:.|.:
  Rat    61 LAIYLLDHFMDQYNVTTSKQLYTVAVSCLLLASKFEDREDRVPKLDQINSTRILSSHNFSLTKKE 125

  Fly   264 LIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKN-----FPDINIGK----VRGHAQAFIS 319
            |:..||.:|....|||...||..||:..:: ..|..|:     :|...:.|    ::.:|..|:.
  Rat   126 LLTTELLLLEAFSWDLCLPTPAHFLDYYLL-ASISQKDHHCHTWPTTCLRKTKECLKEYAHYFLE 189

  Fly   320 LAAKEHKFAKFSASTIAASSIAASMNGLK----W----HLRSGHNLHFLLSLMTDLTSVEQAQVR 376
            :..::|.|.||..|.:||:.:.||...|:    |    ...|.::|..|.:.:..|.......::
  Rat   190 VTLQDHIFYKFQPSVVAAACVGASRICLQLSPYWTRDLQRVSNYSLEHLSTCIEILLVAYDNVLK 254

  Fly   377 DCM-LHMEDIFKEHSRNLEPFLVNIDPKEMST--------------------LYYKRRFQIHQS- 419
            |.: :..:.:....|.:..|..|...|....:                    |.|:...|.|:| 
  Rat   255 DAVAVKSQALAMVPSSSSAPTQVLFQPPTYPSLSQPPPTTLAQFQSPAQDLCLAYRDSLQAHRSG 319

  Fly   420 ---------------QHLSQISIRPLPLPKA----------PAECV 440
                           ..|..:.:.|:|:|.:          |..|:
  Rat   320 TLLSGDTGPSLHTPYPTLQPLDMCPVPVPASLSMQMAIAAEPRHCL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 26/80 (33%)
Cyclin_C 282..>392 CDD:281044 27/127 (21%)
CcnjlNP_001032862.2 CYCLIN_CCNJ-like_rpt1 32..120 CDD:410231 18/58 (31%)
CYCLIN_CCNJ-like_rpt2 144..245 CDD:410232 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339999
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.