DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and ccnd1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_571100.1 Gene:ccnd1 / 30222 ZFINID:ZDB-GENE-980526-176 Length:291 Species:Danio rerio


Alignment Length:264 Identity:106/264 - (40%)
Similarity:158/264 - (59%) Gaps:16/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DNVNTAIGDPTLYSDRCLENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQE 200
            |.:..|..|..|.:||.|:..||.||.:...|:.:..:||:|.|.||||||.||:|||.|:.|:|
Zfish    11 DTIRRAYQDSNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIVPKMRKIVATWMLEVCEEQKCEE 75

  Fly   201 EVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLI 265
            ||..||:||:|||||.:..:||:||:|.|.|:.||||::|..  .|:.:.|.:|||||:...:|:
Zfish    76 EVFPLAMNYLDRFLSVEPTKKTRLQLLGATCMFLASKMKETV--PLTAEKLCIYTDNSVRPGELL 138

  Fly   266 KWELYVLSRLGWDLSSVTPLDFLELLMMRLPI--GSKNFPDINIGKVRGHAQAFISLAAKEHKFA 328
            :.||..|::|.|||:||||.||:|..:.:|||  .||..       :|.|||.|::|.|.:..|.
Zfish   139 QMELLALNKLKWDLASVTPHDFIEHFLAKLPIHQSSKQI-------LRKHAQTFVALCATDVNFI 196

  Fly   329 KFSASTIAASSIAASMNGLKWHLRSGHNLHFLLSLMTDLTSVEQAQ---VRDCMLHMEDIFKEHS 390
            ....|.|||.|:||::.||  :|:|..:.....:|...|:.|.::.   :|.|...:|.:.:...
Zfish   197 ASPPSMIAAGSVAAAVQGL--YLKSTDSCLSSQNLTNFLSQVIRSDPDCLRSCQEQIESLLESSL 259

  Fly   391 RNLE 394
            |..:
Zfish   260 RQAQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 60/124 (48%)
Cyclin_C 282..>392 CDD:281044 36/114 (32%)
ccnd1NP_571100.1 Cyclin_N 27..153 CDD:278560 61/127 (48%)
Cyclin_C 155..269 CDD:281044 37/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579823
Domainoid 1 1.000 128 1.000 Domainoid score I5258
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 189 1.000 Inparanoid score I3880
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001275
OrthoInspector 1 1.000 - - otm25101
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4378
SonicParanoid 1 1.000 - - X1298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1010.020

Return to query results.
Submit another query.