DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccna1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001011949.1 Gene:Ccna1 / 295052 RGDID:1310639 Length:421 Species:Rattus norvegicus


Alignment Length:322 Identity:88/322 - (27%)
Similarity:140/322 - (43%) Gaps:52/322 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 TSHCQRLDERLTTTADPPATDNVNTAIGDPTLYSDRCLENFLKVEEKHHKIPDTYFSIQKDITPP 180
            |:|.|          ...|||..:..| :.|.|::. :..:|:..|..|:....|...|.|||..
  Rat   146 TAHAQ----------SEEATDFGSDVI-NVTEYAEE-IHRYLREAEVRHRPKAHYMRKQPDITEG 198

  Fly   181 MRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLRE--PSC 243
            ||.|:.:|::||..|...:.|.:.||:|::|||||..||.:.:||::..|.:|||||..|  |. 
  Rat   199 MRAILVDWLVEVGEEYKLRTETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAILLASKYEEIYPP- 262

  Fly   244 RALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIG 308
               .||..|..||::..|..|::.|..:|..|.:||:..|...||...:.|..:..:.   .|:.
  Rat   263 ---DVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCIRT---ENLA 321

  Fly   309 KVRGHAQAFISLAAKEHKFAKFSASTIAASSIAASMNGLKWHLRSGHNLHFLLSLMTDLTSVEQA 373
            |.    .|.:||...: .|.|:..|.:||::...: |.:.       |.||....:...|.....
  Rat   322 KY----VAELSLLEAD-PFLKYLPSLVAAAAYCLA-NYIV-------NRHFWPETLAAFTGYSLN 373

  Fly   374 QVRDCM--LHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIRPLPLP 433
            ::..|:  ||...:...|.           |::.....||....:|.|     :...|:.||
  Rat   374 EIVPCLSELHKACLSIPHR-----------PQQAIREKYKASKYLHVS-----LMEPPVVLP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 47/126 (37%)
Cyclin_C 282..>392 CDD:281044 23/111 (21%)
Ccna1NP_001011949.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Cyclin_N2 27..>101 CDD:406812
CYCLIN_CCNA1_rpt1 132..294 CDD:410263 55/163 (34%)
CYCLIN_CCNA1_rpt2 298..420 CDD:410266 31/154 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340013
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.