DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccnj

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001099839.1 Gene:Ccnj / 294053 RGDID:1306399 Length:379 Species:Rattus norvegicus


Alignment Length:293 Identity:72/293 - (24%)
Similarity:123/293 - (41%) Gaps:49/293 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 VVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLRE-----PSCRALS-----VDLLVVYTD 256
            |.||.| :|||:.||..    ||.::|.:|||||||..|     |....|:     .::.:|.| 
  Rat    65 VYLLDL-FMDRYDSSIQ----QLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLT- 123

  Fly   257 NSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMR------LPIGSKNFPDINIGKVR---- 311
                |.:|:..||.:|....|:|...|...|:|..:..      |..|   :|.:.:.|.:    
  Rat   124 ----KQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDG---WPMVCLEKTKLYMA 181

  Fly   312 GHAQAFISLAAKEHKFAKFSASTIAASSIAASMNGLK----WHLRSGHNLHFLLSLMTDLTSVEQ 372
            .:|..|:.::.:::.|..::.|.:||:.:|:|...|:    |..|    ||.|.:...|.  :.|
  Rat   182 KYADYFLEVSLQDYAFLNYAPSLVAAACVASSRIILRLSPTWPTR----LHRLTAYSWDF--LVQ 240

  Fly   373 AQVRDCMLHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIR-PLPLPKAP 436
            ...|..:.|..|:.:.:.:..:....:.......|....|.....|.|:|.|.|:: ..|:.:.|
  Rat   241 CIERLLLAHDNDVKEANKQRGQSAPQSAQLTVFQTAQPSRPVHFQQPQYLHQTSVQYRHPVSEQP 305

  Fly   437 AECVEQHQQQHNFGSAAPHRTHTCKMQAQAQAQ 469
            :     .||..:....:.:...||....|...|
  Rat   306 S-----RQQIVSTTHTSSYTLQTCPAGFQTSVQ 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 30/87 (34%)
Cyclin_C 282..>392 CDD:281044 26/123 (21%)
CcnjNP_001099839.1 CYCLIN 15..>109 CDD:294043 21/48 (44%)
Cyclin_C 145..274 CDD:281044 26/137 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340006
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.