DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccng2

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001099195.1 Gene:Ccng2 / 29157 RGDID:1305002 Length:344 Species:Rattus norvegicus


Alignment Length:302 Identity:63/302 - (20%)
Similarity:111/302 - (36%) Gaps:71/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 EVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLI 265
            |..:||:|.:||||:...|:...|..:...|.|||::|.|..|.......::..:.......|:.
  Rat    75 ETFVLAVNILDRFLALMKVKPKHLSCIGVCCFLLAARLAEEECDIPPTHDVIRISQCKCTASDIK 139

  Fly   266 KWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQAF---------ISLA 321
            :.|..:..:|.::|.:.|.|:||.|.                     ||..|         :||.
  Rat   140 RMEKIISEKLH
YELEATTALNFLHLY---------------------HAIVFCHSPERKEVLSLD 183

  Fly   322 AKEHK---------FAKFSASTIAASSIAASMNGLKWHLRSGHNLHFLLSLMTDLTSVE------ 371
            ..|.:         |:|...|.:|...:...:..:|    |...|..||.:...|...:      
  Rat   184 KLEAQLKACNCRLVFSKAKPSVLALCLLNLEIETIK----SVELLEILLLVKKHLKISDTEFFYW 244

  Fly   372 QAQVRDCMLHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIRPLP-LPKA 435
            :..|..|:       .|:|   .|.....|.|::..:..:|   ..||.|.|..|:..|| :|: 
  Rat   245 RELVSKCL-------AEYS---SPHCCKPDLKKLVWIVSRR---TAQSLHNSYYSVPELPTIPE- 295

  Fly   436 PAECVEQHQQQHNFGSAAPHRTHTCKMQAQAQAQNEIQDVTF 477
             ..|.:..:.:.:      ....:|..::.:.:....|:.||
  Rat   296 -GGCFDGSESEDS------GEDMSCGEESLSSSPPSDQECTF 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 20/78 (26%)
Cyclin_C 282..>392 CDD:281044 25/133 (19%)
Ccng2NP_001099195.1 CYCLIN_CCNG2 55..150 CDD:410287 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340002
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.