DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and ccng2

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_998337.1 Gene:ccng2 / 266794 ZFINID:ZDB-GENE-021016-1 Length:330 Species:Danio rerio


Alignment Length:260 Identity:59/260 - (22%)
Similarity:104/260 - (40%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 EVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLI 265
            :..:||:|.:||||:...|:...|..::..||.:|.::.|..|...|...|:..:.......||.
Zfish    64 QTFVLAVNLLDRFLAMMKVQPKYLACISIGCLHIAVRVTEGECNVSSSHELIRISQCKFTVSDLS 128

  Fly   266 KWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDI-NIGKVRGHAQAFISLAAKEHKFAK 329
            :.|..:..:|.:...:||.|.||.|........:.|..|: |:.|:....:|.:....    |:|
Zfish   129 RMEKIISEKLNF
QFKAVTALTFLHLYHAIALSHTSNRKDVLNLDKLEAQLKACLCRIV----FSK 189

  Fly   330 FSASTIAASSIAASMNGLKWHLRSGHNLHFLLSLMTDLTSVEQAQ-------VRDCMLHMEDIFK 387
            ...|.:|.|.:...:..    |:|...|.....:.|.| .:.:|.       |..|:       :
Zfish   190 AKPSVLALSLLMLEIEA----LQSADLLEIAHRIQTHL-KISKADLGRWRGLVGQCI-------R 242

  Fly   388 EHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIRPLP-LPKAPAECVEQHQQQHNFGS 451
            ::|   .|.....|.|::..:..:|   ..|:.|.|..||..|| :|:...:..|......:..|
Zfish   243 DYS---SPECAKPDHKKLVWIVSRR---TAQNLHSSYCSIPELPTIPEGVWDESESEDSSEDLSS 301

  Fly   452  451
            Zfish   302  301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 20/78 (26%)
Cyclin_C 282..>392 CDD:281044 25/117 (21%)
ccng2NP_998337.1 CYCLIN <59..140 CDD:294043 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.