DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccne1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001094291.1 Gene:Ccne1 / 25729 RGDID:2294 Length:411 Species:Rattus norvegicus


Alignment Length:432 Identity:87/432 - (20%)
Similarity:152/432 - (35%) Gaps:163/432 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EPPTSHCQRLDERLTTTADPPATDNVNTAIGDPTLYSDRCLENFL----KVEEKHHKIPDTYFSI 173
            :.|.....::|:.:.:.......|: ::|..||      |  :|:    |.|:...:.|.|.|..
  Rat    40 QDPDEEIAKIDKTVKSQDSSQPWDD-DSACVDP------C--SFIPTPNKEEDNELEYPKTAFQP 95

  Fly   174 QKDITPP-------------------------------------------MRKIVAEWMMEVCAE 195
            :| |.||                                           ||.::.:|:||||..
  Rat    96 RK-IRPPRASPLPVLNWGNREEVWRIMLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEV 159

  Fly   196 ENCQEEVVLLALNYMDRFLSS-KSVRKTQLQILAAACLLLASKLRE---PSCRALSVDLLVVYTD 256
            .....|...||.::.||:::| :::.||.||::..:.|.:||||.|   |.....:     ..||
  Rat   160 YKLHRETFYLAQDFFDRYMASQQNIIKTLLQLIGISALFIASKLEEIYPPKLHQFA-----YVTD 219

  Fly   257 NSIYKDDLIKWELYVLSRLGWDLSSVTPLDFL-------------ELLMMRLPIGSKNFPDINIG 308
            .:...|:::..||.::..|.|.||.:|.:.:|             |:||.:.|            
  Rat   220 GACSGDEILTMELMMMKALKWRLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYP------------ 272

  Fly   309 KVRGHAQAFISLA------AKEHKFAKFSASTIAASSIAASMNGLKWHLRSGHNLHFLLSLMTDL 367
                 .|.|:.:|      ..:....:|....:|||::        :|..|       |.||..:
  Rat   273 -----QQVFVQIAELLDLCVLDVGCLEFPYGVLAASAL--------YHFSS-------LELMQKV 317

  Fly   368 TSVEQAQVRDCMLHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIRPLPL 432
            :..:...:..|:..|           .||.:.|  :||.:...|.              .|.:|:
  Rat   318 SGYQWCDIEKCVKWM-----------VPFAMVI--REMGSSKLKH--------------FRGVPM 355

  Fly   433 PKAPAECVEQHQQQHNFGSAAPHRTHTCKMQA--QAQAQNEI 472
                       :..||.      :|||..:..  :|||:..|
  Rat   356 -----------EDSHNI------QTHTNSLDLLDKAQAKKAI 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 41/175 (23%)
Cyclin_C 282..>392 CDD:281044 20/128 (16%)
Ccne1NP_001094291.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 1/3 (33%)
CYCLIN_SF 104..240 CDD:424085 30/140 (21%)
CYCLIN_CCNE1_rpt2 244..357 CDD:410284 28/182 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..411 87/432 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.