DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccnj

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_766427.1 Gene:Ccnj / 240665 MGIID:2443297 Length:379 Species:Mus musculus


Alignment Length:290 Identity:67/290 - (23%)
Similarity:119/290 - (41%) Gaps:44/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LALNYMDRFLSSKSVRKTQLQILAAACLLLASKLRE-----PSCRALS-----VDLLVVYTDNSI 259
            ||:..:|.|:....:...||.::|.:|||||||..|     |....|:     .::.:|.|    
Mouse    63 LAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLT---- 123

  Fly   260 YKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMR------LPIGSKNFPDINIGKVR----GHA 314
             |..|:..||.:|....|:|...|...|:|..:..      |..|   :|.:.:.|.:    .:|
Mouse   124 -KQTLLHMELLLLETFQW
NLCLPTAAHFIEYYLSEAVHETDLHDG---WPMVCLEKTKLYMAKYA 184

  Fly   315 QAFISLAAKEHKFAKFSASTIAASSIAASMNGLK----WHLRSGHNLHFLLSLMTDLTSVEQAQV 375
            ..|:.::.:::.|..::.|.:||:.:|:|...|:    |..|    ||.|.:...|.  :.|...
Mouse   185 DYFLEVSLQDYAFLNYAPSLVAAACVASSRIILRLSPTWPTR----LHRLTAYSWDF--LVQCIE 243

  Fly   376 RDCMLHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIR-PLPLPKAPAEC 439
            |..:.|..|:.:.:.:..:....:.......|....|.....|.|:|.|.|:: ..|:.:.|:  
Mouse   244 RLLLAHDNDVKEANKQRGQSAPQSTQLTVFQTAQPSRPVHFQQPQYLHQSSLQYRHPVSEQPS-- 306

  Fly   440 VEQHQQQHNFGSAAPHRTHTCKMQAQAQAQ 469
               .||..:....:.:...||....|...|
Mouse   307 ---RQQIVSTTHTSSYTLQTCPAGFQTSVQ 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 25/84 (30%)
Cyclin_C 282..>392 CDD:281044 26/123 (21%)
CcnjNP_766427.1 CYCLIN_CCNJ-like_rpt1 34..140 CDD:410231 24/81 (30%)
CYCLIN_CCNJ-like_rpt2 145..245 CDD:410232 23/108 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836339
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.