DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccni

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_059063.2 Gene:Ccni / 12453 MGIID:1341077 Length:377 Species:Mus musculus


Alignment Length:361 Identity:76/361 - (21%)
Similarity:139/361 - (38%) Gaps:86/361 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSK 217
            ||..:..|.:..|:........::::|..|..|.:|:.::..:.|...|...||.:.:||||::.
Mouse    16 LERAISREAQMWKVNVPKIPTNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASSLLDRFLATV 80

  Fly   218 SVRKTQLQILAAACLLLASKLRE-----PSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGW 277
            ......|..:|.:|..||:|..|     |..:.|:.|...     .....::::.|..:|.:|.|
Mouse    81 KAHPKYLNCIAISCFFLAAKTVEEDEKIPVLKVLARDSFC-----GCSSSEILRMERIILDKLNW 140

  Fly   278 DLSSVTPLDFLEL-----------LMMRLPIGSKNFPDINIG---KVRGHAQAFISLAAKEHKFA 328
            ||.:.||||||.:           |:..||   |..|..::.   |...|..|.       ::..
Mouse   141 DLHTATPLDFLHIFHAIAVSARPQLLFSLP---KLSPSQHLAVLTKQLLHCMAC-------NQLL 195

  Fly   329 KFSASTIAASSIAASMNGL--KWHLRSGHNLHFLLSLMTDLTSVEQAQVRDC-MLHMEDIFKEHS 390
            :|..|.:|.:.::..|..|  .|           |.|..:|  :::||:... ::|..::...|.
Mouse   196 QFKGSMLALAMVSLEMEKLIPDW-----------LPLTIEL--LQKAQMDSSQLIHCRELVAYHL 247

  Fly   391 RNLEPFLVNIDPKEMSTLYY------------KRRFQIHQSQHLSQISIRPLPLPKAPAECVEQH 443
            ..|:..|      .::::|.            |..|::|.|........:....|:.|..     
Mouse   248 SALQSAL------PLNSVYVYRPLKHTLVTCDKGAFKLHPSSVSGPDFSKDNSKPEVPVR----- 301

  Fly   444 QQQHNFGSAAPH----RTHTCKMQAQAQAQNEIQDV 475
                  |.||.|    ....||   |..|:.:::::
Mouse   302 ------GPAAFHLHLPAASGCK---QTSAKRKVEEM 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 29/129 (22%)
Cyclin_C 282..>392 CDD:281044 27/126 (21%)
CcniNP_059063.2 Cyclin_N 39..142 CDD:365896 26/107 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.