DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccng1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_033961.1 Gene:Ccng1 / 12450 MGIID:102890 Length:294 Species:Mus musculus


Alignment Length:189 Identity:52/189 - (27%)
Similarity:82/189 - (43%) Gaps:37/189 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 EVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRA-LSVDLLVVYTDNSIYK--- 261
            |...||:|.:|||||...|:...|..:..:|..||.|..|..... |:.||:.:    |.|:   
Mouse    70 ETFSLAVNLLDRFLSKMKVQAKHLGCVGLSCFYLAVKATEEERNVPLATDLIRI----SQYRFTV 130

  Fly   262 DDLIKWELYVLSRLGWDLSSVTPLDFLELLMM----RLPIGSKNFPDINIGKVRGHAQAFISLAA 322
            .||::.|..||.::.|.:.:.|...||:|...    .||...:|  |:|..::....:|.     
Mouse   131 SDLMRMEKIVLEKVCWKV
KATTAFQFLQLYYSLVHDTLPFERRN--DLNFERLEAQLKAC----- 188

  Fly   323 KEH---KFAKFSASTIAASSIAASMNGLKW------------HLR-SGHNLHFLLSLMT 365
              |   .|:|...|.:|.|.:|..:..||:            |.: ||.:|.|...|::
Mouse   189 --HCRIIFSKAKPSVLALSILALEIQALKYVELTEGVECIQKHSKISGRDLTFWQELVS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 27/82 (33%)
Cyclin_C 282..>392 CDD:281044 25/104 (24%)
Ccng1NP_033961.1 Cyclin_N 16..148 CDD:278560 27/81 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836329
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.