DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccnf

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_006523617.1 Gene:Ccnf / 12449 MGIID:102551 Length:790 Species:Mus musculus


Alignment Length:332 Identity:71/332 - (21%)
Similarity:140/332 - (42%) Gaps:78/332 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 FSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLA 235
            ||:||.::..||.|:.:|::||...::.....:.|.:..:||:|..:.|.:.:||:|..||:::.
Mouse   312 FSVQKGLSDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLRRRLVPRYKLQLLGIACMVIC 376

  Fly   236 SKLREPSCRALSVDLLVV-----YTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRL 295
            :       |.:|.::|.:     .|||:...:||::....::|.|...:...|.:|:.|:|:..:
Mouse   377 T-------RFISKEILTIREAVWLTDNTYKYEDLVRVMGEIISALEGKIR
IPTVVDYKEVLLTLV 434

  Fly   296 PIGSKNFPDINIGKVRGHAQAFISLAAKEHKFAKFSASTIAASS---IAASMNG--LKW--HLRS 353
            |:..:.          .|..:|:......|......|....||:   :|..|:|  ..|  ||  
Mouse   435 PVAPRT----------QHLCSFLCELTLLHTSLSIYAPARLASAALLLARLMHGQTQPWTTHL-- 487

  Fly   354 GHNLHFLLSLMTDLTSVEQAQVRDCMLHM-EDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRF--- 414
                       .|||....:.:..|:|.: :..|.:.:..        |.:::|....|:||   
Mouse   488 -----------WDLTGFSYSDLVPCVLSLHKKCFHDDAPK--------DYRQVSLTAVKQRFEDK 533

  Fly   415 ---QIHQSQHLSQISI---------RPLPLPKAPAECVEQHQQQHNFGSAAPHRTHTCKMQAQAQ 467
               :|.:.:.||...:         .|.| |..|:.     .:.|.|.|:...|      :::.:
Mouse   534 CYEEISREEVLSYADLCSTIGVKQESPEP-PSFPSS-----GEIHTFLSSPSGR------RSKRK 586

  Fly   468 AQNEIQD 474
            .:|.:|:
Mouse   587 RENSLQE 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 30/113 (27%)
Cyclin_C 282..>392 CDD:281044 23/117 (20%)
CcnfXP_006523617.1 FBOX 48..86 CDD:197608
Cyclin_N 296..419 CDD:365896 30/113 (27%)
Cyclin_C 438..544 CDD:367282 24/136 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836340
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.