DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccne2

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001032211.1 Gene:Ccne2 / 12448 MGIID:1329034 Length:404 Species:Mus musculus


Alignment Length:325 Identity:78/325 - (24%)
Similarity:134/325 - (41%) Gaps:60/325 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 AKNPEQLEPPPPPPPPPPPPPTATQSIQSYPRYISQE--------------------PPT----- 116
            ::...:|:......|..|..|..||.||:..|..:|:                    ||.     
Mouse     2 SRRSSRLQAKQHAQPNQPDSPQETQIIQAKKRKTAQDVKKRKEEITKKHQYEIRNCWPPVLSGGI 66

  Fly   117 SHCQRLD--ERLTTTADPPATDNV---NTAIGDPTL------YSDRCLENFLKVEEKHHKIPDTY 170
            |.|..::  .:...|:|.....|.   |..|....|      .|....:|.|:.|.::  :.|.:
Mouse    67 SPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWACSQEVWQNMLQKENRY--VHDKH 129

  Fly   171 FSI-QKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRF-LSSKSVRKTQLQILAAACLL 233
            |.: ..|:.|.||.|:.:|::|||.......|...||.::.||| |:.|.|.|..||::....|.
Mouse   130 FQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDVNKNMLQLIGITSLF 194

  Fly   234 LASKLREPSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIG 298
            :||||.|  ..|..:......||.:..:.|::|.||.:|..|.|:|..||.:.:|.|.:....: 
Mouse   195 IASKLEE--IYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELCPVTVISWLNLFLQVDAV- 256

  Fly   299 SKNFPDINIGKVRGHAQAFISLA-----------AKEHKFAKFSASTI---AASSIAASMNGLKW 349
             |:.|.:.:.:.  ..:.||.:|           :.|.::...:|:.:   .:..:....:||:|
Mouse   257 -KDVPKVLLPQY--SQETFIQIAQLLDLCILAIDSLEFQYRILAAAALCHFTSIEVVKKASGLEW 318

  Fly   350  349
            Mouse   319  318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 42/126 (33%)
Cyclin_C 282..>392 CDD:281044 14/82 (17%)
Ccne2NP_001032211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 10/38 (26%)
Cyclin_N 112..239 CDD:365896 42/130 (32%)
Cyclin_C 241..361 CDD:367282 14/82 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.