DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccne1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_031659.2 Gene:Ccne1 / 12447 MGIID:88316 Length:408 Species:Mus musculus


Alignment Length:421 Identity:82/421 - (19%)
Similarity:150/421 - (35%) Gaps:137/421 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EPPTSHCQRLDERLTTTADPPATDNVNTAIGDPTLYSDRCLENFL----KVEEKHHKIPDTYFSI 173
            :.|.....::|:.:.:.......|: |:|..||      |  :|:    |.|:...:.|.|.|..
Mouse    37 QDPDEEIAKIDKTVKSEDSSQPWDD-NSACVDP------C--SFIPTPNKEEDNELEYPRTAFQP 92

  Fly   174 QKDITPP-------------------------------------------MRKIVAEWMMEVCAE 195
            :| |.||                                           ||.::.:|:||||..
Mouse    93 RK-IRPPRASPLPVLNWGNREEVWRIMLNKEKTYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEV 156

  Fly   196 ENCQEEVVLLALNYMDRFLSSK-SVRKTQLQILAAACLLLASKLRE---PSCRALSVDLLVVYTD 256
            .....|...||.::.||:::|: ::.||.||::..:.|.:||||.|   |.....:     ..||
Mouse   157 YKLHRETFYLAQDFFDRYMASQHNIIKTLLQLIGISALFIASKLEEIYPPKLHQFA-----YVTD 216

  Fly   257 NSIYKDDLIKWELYVLSRLGWDLSSVTPLDFL-------------ELLMMRLPIGSKNFPDINIG 308
            .:...|:::..||.::..|.|.||.:|.:.:|             |:||.:.|            
Mouse   217 GACSGDEILTMELMMMKALKWRLSPLTIVSWLNVYVQVAYVNDTGEVLMPQYP------------ 269

  Fly   309 KVRGHAQAFISLA------AKEHKFAKFSASTIAASSIAASMNGLKWHLRSGHNLHFLLSLMTDL 367
                 .|.|:.:|      ..:....:|....:|||::        :|..|       |.||..:
Mouse   270 -----QQVFVQIAELLDLCVLDVGCLEFPYGVLAASAL--------YHFSS-------LELMQKV 314

  Fly   368 TSVEQAQVRDC------------------MLHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRF 414
            :..:...:..|                  :.|...:..|.|.|::....::|..:.:..  |:..
Mouse   315 SGYQWCDIEKCVKWMVPFAMVIREMGSSKLKHFRGVPMEDSHNIQTHTNSLDLLDKAQA--KKAI 377

  Fly   415 QIHQSQHLSQISIRPLPLPKAPAECVEQHQQ 445
            ...|::.....|:...|.|.:..:..||..:
Mouse   378 LSEQNRISPPPSVVLTPPPSSKKQSSEQETE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 41/175 (23%)
Cyclin_C 282..>392 CDD:281044 22/146 (15%)
Ccne1NP_031659.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Cyclin_N 113..240 CDD:278560 31/131 (24%)
Cyclin_C 243..362 CDD:281044 23/150 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..408 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836341
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.