DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccnd1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001366177.1 Gene:Ccnd1 / 12443 MGIID:88313 Length:317 Species:Mus musculus


Alignment Length:293 Identity:107/293 - (36%)
Similarity:162/293 - (55%) Gaps:37/293 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DNVNTAIGDPTLYSDRCLENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQE 200
            :.:..|..|..|.:||.|...||.||........:..:||:|.|.||||||.||:|||.|:.|:|
Mouse    11 ETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIVATWMLEVCEEQKCEE 75

  Fly   201 EVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLI 265
            ||..||:||:|||||.:.::|::||:|.|.|:.:|||::|..  .|:.:.|.:||||||..::|:
Mouse    76 EVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETI--PLTAEKLCIYTDNSIRPEELL 138

  Fly   266 KWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKFAKF 330
            :.||.::::|.|:|:::||.||:|..:.::|..     |.|...:|.|||.|::|.|.:.||...
Mouse   139 QMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEA-----DENKQTIRKHAQTFVALCATDVKFISN 198

  Fly   331 SASTIAASSIAASMNGLKWHLRSGHNL-------HFL---------------LSLMTD---LTSV 370
            ..|.:||.|:.|:|.||  :|.|.:|.       |||               |.|..|   |...
Mouse   199 PPSMVAAGSVVAAMQGL--NLGSPNNFLSCYRTTHFLSRVIKCDPVKALATGLWLNKDPLHLRPP 261

  Fly   371 EQAQVRDCMLHMEDIFKEHSRNLEPFLVNIDPK 403
            .|..:|.|...:|.:.:...|..:.   |:|||
Mouse   262 LQDCLRACQEQIEALLESSLRQAQQ---NVDPK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 56/124 (45%)
Cyclin_C 282..>392 CDD:281044 39/134 (29%)
Ccnd1NP_001366177.1 CYCLIN_CCND1_rpt1 3..151 CDD:410276 61/141 (43%)
CYCLIN_CCND1_rpt2 156..287 CDD:410279 40/140 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836344
Domainoid 1 1.000 125 1.000 Domainoid score I5444
eggNOG 1 0.900 - - E1_KOG0656
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I4065
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001275
OrthoInspector 1 1.000 - - otm43415
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10177
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4378
SonicParanoid 1 1.000 - - X1298
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.880

Return to query results.
Submit another query.