DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and Ccna1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001292150.1 Gene:Ccna1 / 12427 MGIID:108042 Length:421 Species:Mus musculus


Alignment Length:323 Identity:89/323 - (27%)
Similarity:141/323 - (43%) Gaps:52/323 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PTSHCQRLDERLTTTADPPATDNVNTAIGDPTLYSDRCLENFLKVEEKHHKIPDTYFSIQKDITP 179
            ||:|.|          ...|||..:..| :.|.|::. :..:|:..|..|:....|...|.|||.
Mouse   145 PTTHAQ----------SEEATDFGSDVI-NVTEYAEE-IHRYLREAEVRHRPKAHYMRKQPDITE 197

  Fly   180 PMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLRE--PS 242
            .||.|:.:|::||..|...:.|.:.||:|::|||||..||.:.:||::..|.:|||||..|  |.
Mouse   198 GMRAILVDWLVEVGEEYKLRTETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAILLASKYEEIYPP 262

  Fly   243 CRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINI 307
                .||..|..||::..|..|::.|..:|..|.:||:..|...||...:.|..:..:.   .|:
Mouse   263 ----DVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCIRT---ENL 320

  Fly   308 GKVRGHAQAFISLAAKEHKFAKFSASTIAASSIAASMNGLKWHLRSGHNLHFLLSLMTDLTSVEQ 372
            .|.    .|.:||...: .|.|:..|.:||::...: |.:.       |.||....:...|....
Mouse   321 AKY----VAELSLLEAD-PFLKYLPSLVAAAAYCLA-NYIV-------NRHFWPETLAAFTGYSL 372

  Fly   373 AQVRDCM--LHMEDIFKEHSRNLEPFLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIRPLPLP 433
            .::..|:  ||...:...|.           |::.....||....:|.|     :...|:.||
Mouse   373 NEIVPCLSELHKACLSIPHR-----------PQQAIREKYKASKYLHVS-----LMEPPVVLP 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 47/126 (37%)
Cyclin_C 282..>392 CDD:281044 23/111 (21%)
Ccna1NP_001292150.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Cyclin_N2 27..>101 CDD:406812
CYCLIN_CCNA1_rpt1 132..294 CDD:410263 56/164 (34%)
CYCLIN_CCNA1_rpt2 298..420 CDD:410266 31/154 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.