DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CCNI

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001335061.1 Gene:CCNI / 10983 HGNCID:1595 Length:377 Species:Homo sapiens


Alignment Length:299 Identity:68/299 - (22%)
Similarity:124/299 - (41%) Gaps:64/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSK 217
            ||..:..|.:..|:........::::|..|..|.:|:.::..:.|...|...||.:.:||||::.
Human    16 LEKAITREAQMWKVNVRKMPSNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASSLLDRFLATV 80

  Fly   218 SVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSI---YKDDLIKWELYVLSRLGWDL 279
            ......|..:|.:|..||:|..|...|   :.:|.|...:|.   ...::::.|..:|.:|.|||
Human    81 KAHPKYLSCIAISCFFLAAKTVEEDER---IPVLKVLARDSFCGCSSSEILRMERIILDKLNWDL 142

  Fly   280 SSVTPLDFLEL-----------LMMRLPIGSKNFPDINIG---KVRGHAQAFISLAAKEHKFAKF 330
            .:.||||||.:           |:..||   |..|..::.   |...|..|.       ::..:|
Human   143 HTATPLDFLHIFHAIAVSTRPQLLFSLP---KLSPSQHLAVLTKQLLHCMAC-------NQLLQF 197

  Fly   331 SASTIAASSIAASMNGL--KWHLRSGHNLHFLLSLMTDLTSVEQAQVRDC-MLHMEDIFKEHSRN 392
            ..|.:|.:.::..|..|  .|           |||..:|  :::||:... ::|..::...|...
Human   198 RGSMLALAMVSLEMEKLIPDW-----------LSLTIEL--LQKAQMDSSQLIHCRELVAHHLST 249

  Fly   393 LEPFLVNIDPKEMSTLYYKRR------------FQIHQS 419
            |:..|      .::::|..|.            |::|.|
Human   250 LQSSL------PLNSVYVYRPLKHTLVTCDKGVFRLHPS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 30/127 (24%)
Cyclin_C 282..>392 CDD:281044 28/126 (22%)
CCNINP_001335061.1 Cyclin_N 34..142 CDD:365896 27/110 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146227
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.