DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and CCNO

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_066970.3 Gene:CCNO / 10309 HGNCID:18576 Length:350 Species:Homo sapiens


Alignment Length:317 Identity:74/317 - (23%)
Similarity:121/317 - (38%) Gaps:25/317 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 EPPPPPPPPPPPPPTATQSIQSYPRYISQEPPTSHCQRLDERLTTTADPPATDNVNTAIGDPTLY 148
            :|..|..|.|.|..:....:...|...|....:....|....|...|.|.|..::.| ..|   |
Human    41 QPLHPLNPCPLPGDSGICDLFESPSSGSDGAESPSAARGGSPLPGPAQPVAQLDLQT-FRD---Y 101

  Fly   149 SDRCLENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRF 213
            ...|.. |.|.:|.|.. |....:.|..:|...|..:..|::.|..:.....|.:.|.:|.:|||
Human   102 GQSCYA-FRKAQESHFH-PREALARQPQVTAESRCKLLSWLIPVHRQFGLSFESLCLTVNTLDRF 164

  Fly   214 LSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWD 278
            |::..|.....|:|....||:|.|  :.......|..|:.....:..:..|...|..||.:|.:.
Human   165 LTTTPVAADCFQLLGVTSLLIACK--QVEVHPPRVKQLLALCCGAFSRQQLCNLECIVLHKLHFT 227

  Fly   279 LSSVTPLDFLE-LLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKFAKFSASTIAASSIAA 342
            |.:.|...||| ....|:..|.....:....:......|.:|||  ::.|..:|.|.:|...:|.
Human   228 LGAPTISFFLEHFTHARVEAGQAEASEALEAQALARGVAELSLA--DYAFTSYSPSLLAICCLAL 290

  Fly   343 SMNGLKWHLRSGHNLHFLLSLMTDLTSVE--QAQVRDCMLHMEDIFKEHSRNLEPFL 397
            :...|:            :|...||...:  :|.:.|||..::.:...:|.:|...|
Human   291 ADRMLR------------VSRPVDLRLGDHPEAALEDCMGKLQLLVAINSTSLTHML 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 31/124 (25%)
Cyclin_C 282..>392 CDD:281044 24/112 (21%)
CCNONP_066970.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 10/47 (21%)
Cyclin_N 108..229 CDD:278560 31/123 (25%)
Cyclin_C 231..>296 CDD:281044 15/66 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.