DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and ccno

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001373739.1 Gene:ccno / 101883490 -ID:- Length:300 Species:Danio rerio


Alignment Length:232 Identity:59/232 - (25%)
Similarity:94/232 - (40%) Gaps:23/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 SIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLAS 236
            |.|..||...|..:..|::.|..:.:...|...||:|.|||||.:.||.....|:|....||:|:
Zfish    59 SRQPQITAEARSKLVSWLIAVRRQLSLSFESCCLAVNIMDRFLITTSVAADCFQLLGVTSLLIAT 123

  Fly   237 KLREPSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLP----- 296
            |  :....:..:..|:....||..::.|...|..:|.||.:.|::.|...||:....|..     
Zfish   124 K--QVEVYSPRITQLLSLCCNSFSREQLCNLECLILLRLNFRLAAPTLAFFLDYFTSRFTGHQTG 186

  Fly   297 --IGSKNF-----PDINIGKVRGHAQAFISLAAKEHKFAKFSASTIAASSIAASMNGLKWHL--- 351
              |.::|.     |.....|.|..|.....|:..::.|.|:..|.||..::..:.:.||...   
Zfish   187 EFISAQNAHLHKEPSSAENKWRWLACKVCELSLADYTFNKYMPSVIAQCALKLAKDLLKTQSVQN 251

  Fly   352 ---RSGHNLHFLLSLMTDLTSVEQAQVRDCMLHMEDI 385
               .:|.:..........||...|...:.|   |||:
Zfish   252 SEDNTGASKMLCCEEEAPLTCENQLLFQQC---MEDL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 32/107 (30%)
Cyclin_C 282..>392 CDD:281044 26/122 (21%)
ccnoNP_001373739.1 CYCLIN_SF 68..160 CDD:424085 26/93 (28%)
CYCLIN_SF 167..291 CDD:424085 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579821
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.