DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and XB997834

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_017951851.1 Gene:XB997834 / 100487861 XenbaseID:XB-GENE-997835 Length:327 Species:Xenopus tropicalis


Alignment Length:292 Identity:70/292 - (23%)
Similarity:114/292 - (39%) Gaps:46/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PPATDNVNTAIGD--PTL-----YSDRCLENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWM 189
            ||..|..|| .|:  .||     |.:.|......:||..  ||..:.:.|.||.....|.|...|
 Frog    39 PPVQDPWNT-FGNMADTLQTFMDYGETCYMFKKSLEEDF--IPHNFLANQSDINAKCWKDVVITM 100

  Fly   190 MEVCAEENCQEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVY 254
            :..........|.:.||:||::|||:...::...|:::...||.||.|:.|.|...:: ..|.::
 Frog   101 IIAHRAFKLDFETLCLAVNYLERFLACTPLKAANLKVMGGTCLYLACKVMEKSLPKIN-QFLALF 164

  Fly   255 TDNSIYKDDLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRG---HAQA 316
            .::......:...|..||.||.:.|.:.|...|||...:| .:.:|..|...|.:...   .|:.
 Frog   165 CEDGFTAPLMSYLERLVLRRLCFRLGAPTIEYFLEHFSLR-RVSNKECPAAKINRAANALTAARG 228

  Fly   317 FISLAAKEHKFAKFSASTIAASSIAASMN----------------GLKWHLRSGHNLHFLLSLMT 365
            ..:|:..::.|..:..|.:|...:.|:..                |..|....|:        :|
 Frog   229 IAALSMTKYGFPAYPPSLLAQCCLTAADQIFQYDPWNRVHPRDCLGPLWQECMGN--------IT 285

  Fly   366 DLTSVEQAQVRDCMLH--MEDIFKEHSRNLEP 395
            .|.||.:     ...|  |..:|.|...:|.|
 Frog   286 HLVSVNK-----IFFHKIMPGVFPETFPDLVP 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 32/124 (26%)
Cyclin_C 282..>392 CDD:281044 25/130 (19%)
XB997834XP_017951851.1 Cyclin_N 66..190 CDD:365896 32/126 (25%)
Cyclin_C 192..>268 CDD:367282 14/76 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.