DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and ccni2

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001096463.1 Gene:ccni2 / 100125081 XenbaseID:XB-GENE-5874358 Length:358 Species:Xenopus tropicalis


Alignment Length:300 Identity:76/300 - (25%)
Similarity:126/300 - (42%) Gaps:43/300 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LENFLKVEEKHHKIPDTYFSIQK--DITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLS 215
            |||.|::|:...|:|.......|  ||:....:....|:.||........|...||::.::|.|:
 Frog    16 LENSLQLEDTKWKVPAFEGGTLKGTDISLTHYEQAILWIDEVTLRFRFYPETFGLAVSILNRILA 80

  Fly   216 SKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLIKWELYVLSRLGWDLS 280
            |..|:...|:.:...||.||:|..|......||..|.|.:.......::::.|..||.:|.|||.
 Frog    81 SVKVQVKYLRCITVTCLFLAAKTNEEDEIIPSVKRLAVQSGCMCSPAEILRMERIVLDKLQWDLC 145

  Fly   281 SVTPLDFLE----LLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKE-------HKFAKFSAST 334
            :.||:|||.    :||..||   ..|.|.    :|.:..:.::|..::       |:..:|..||
 Frog   146 TATPVDFLNTFHAMLMSNLP---HLFHDC----LRMNPSSHLALLTRQLQQCMACHQLVQFRGST 203

  Fly   335 IAASSIAASMNGL--KWHLRSGHNLHFLLSLMTDL---TSVEQAQVRDCMLHMEDIFKEHSRNLE 394
            :|...|...:..|  .|           ...:|:|   ..|:.|:...|    :::..:|...|.
 Frog   204 LALVIITLELEKLTADW-----------FPAITELLKKAKVDSAKFILC----KELVDQHLGMLS 253

  Fly   395 P---FLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIRPLP 431
            |   ..|.|..|.....|:|::......|.:|:....|:|
 Frog   254 PSNHVYVFIPAKRNPQAYHKQKSSACSPQPISRNMNPPIP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 35/126 (28%)
Cyclin_C 282..>392 CDD:281044 27/125 (22%)
ccni2NP_001096463.1 Cyclin_N 44..145 CDD:278560 27/100 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.