DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and ccnb1

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_031753568.1 Gene:ccnb1 / 100101736 XenbaseID:XB-GENE-921525 Length:392 Species:Xenopus tropicalis


Alignment Length:340 Identity:80/340 - (23%)
Similarity:132/340 - (38%) Gaps:74/340 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PEQLEPPPPPPPPPPPPPTATQSIQSYPRYISQEPPTSHCQRLDERLTTTADPPATDNVNTAIGD 144
            |::.|.|.|..|.|         :::....|.:.||.     ....|....|..|.|:.|     
 Frog    79 PKEAETPVPDSPNP---------METSVCVIEEIPPA-----FSSALIPIKDVDAEDSDN----- 124

  Fly   145 PTLYSD--RCLENFLKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLAL 207
            |.|.||  :.:..:|:..|....|...|...| :|...||.|:.:|:::|.......:|.:.:.:
 Frog   125 PMLCSDYVKDIYCYLRNMEVKQAIRPRYLDGQ-EINGNMRAILVDWLVQVHLRFKLLQETMSMTI 188

  Fly   208 NYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKDDLIKWELYVL 272
            ..:||||....|.|..||:...:.:.:|.|..|..|.::. |...| ||::..|..:...|:.:|
 Frog   189 AILDRFLQENPVPKKLLQLAGVSAMFIACKYEEIYCPSIG-DFAFV-TDHTYTKSQIRNMEMQIL 251

  Fly   273 SRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRG--H--AQAFISLAAKEHKFAKFSAS 333
            ..|.:|:....||.||..       .||      ||:|..  |  |:..|.|...::.......|
 Frog   252 RVLKFDIGRPLPLHFLRR-------ASK------IGEVDSVHHTLAKYLIELVMTDYDMVHVPPS 303

  Fly   334 TIAASSIAASM---NGLKW--------------------HL-------RSGHNLHFLLSLMTDLT 368
            .:||::...:|   |..:|                    |:       ..||..  .||:.:..:
 Frog   304 QLAAAAFCLAMKILNSGEWTPVLEHYMAYKESSLMPVMQHIAKNIVKVNGGHTK--FLSVKSKYS 366

  Fly   369 SVEQAQVRDCMLHME 383
            |..|.:| .|:.|::
 Frog   367 SSRQMKV-SCLPHLK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 33/124 (27%)
Cyclin_C 282..>392 CDD:281044 29/136 (21%)
ccnb1XP_031753568.1 CYCLIN_SF 128..256 CDD:424085 34/130 (26%)
CYCLIN_SF 261..381 CDD:424085 29/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.