DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and ccnd2

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:XP_002940348.2 Gene:ccnd2 / 100038071 XenbaseID:XB-GENE-481219 Length:290 Species:Xenopus tropicalis


Alignment Length:267 Identity:113/267 - (42%)
Similarity:157/267 - (58%) Gaps:22/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DNVNTAIGDPT-LYSDRCLENFLKVEEKHHKIPD-TYFS-IQKDITPPMRKIVAEWMMEVCAEEN 197
            |.|..|..||| |..||.|.|.|.|||::  :|. :||. :||||.|.||::||.||:|||.|:.
 Frog     9 DTVRRAQADPTLLLDDRVLHNLLTVEERY--LPQCSYFKCVQKDIQPFMRRMVATWMLEVCEEQR 71

  Fly   198 CQEEVVLLALNYMDRFLSSKSVRKTQLQILAAACLLLASKLREPSCRALSVDLLVVYTDNSIYKD 262
            |:|||..||:||:||||:....||..||:|.|.|:.|||||:|..  .|:.:.|.:||||||...
 Frog    72 CEEEVFPLAMNYLDRFLAVIPTRKCHLQLLGAVCMFLASKLKETI--PLTAEKLCIYTDNSIKPQ 134

  Fly   263 DLIKWELYVLSRLGWDLSSVTPLDFLELLMMRLPIGSKNFPDINIGKVRGHAQAFISLAAKEHKF 327
            :|::|||.||.:|.|:|::|||.||:|.::.:||:     |...:..:|.|||.||:|.|.:..|
 Frog   135 ELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPL-----PKEKLLLIRKHAQTFIALCATDFNF 194

  Fly   328 AKFSASTIAASSIAASMNGLKWHLRSGHNLHFLLSLMTDLTSVEQAQVRDCMLHMEDIFKEHSRN 392
            |.:..|.||..|:.|::.||:  |..|.......||...|..:....| ||:       |.....
 Frog   195 AMYPPSMIATGSVGAAICGLQ--LDDGETSFSGDSLTEHLAKITSTDV-DCL-------KACQEQ 249

  Fly   393 LEPFLVN 399
            :|..||:
 Frog   250 IESVLVS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 64/126 (51%)
Cyclin_C 282..>392 CDD:281044 35/109 (32%)
ccnd2XP_002940348.2 Cyclin_N 25..152 CDD:365896 66/130 (51%)
Cyclin_C 154..265 CDD:367282 38/118 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37525
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.