DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycD and ccnjl

DIOPT Version :9

Sequence 1:NP_523355.2 Gene:CycD / 32551 FlyBaseID:FBgn0010315 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001296774.1 Gene:ccnjl / 100001904 ZFINID:ZDB-GENE-030131-9888 Length:407 Species:Danio rerio


Alignment Length:341 Identity:84/341 - (24%)
Similarity:143/341 - (41%) Gaps:68/341 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 LKVEEKHHKIPDTYFSIQKDITPPMRKIVAEWMMEVCAEENCQEEVVLLALNYMDRFLSSKSVRK 221
            |:::|.  |:| ||.:....|  .||:..|:.:..:............||:..:|.|:....|..
Zfish    23 LRIKEL--KLP-TYQAHSPQI--GMRRYFADLLAVLSNRYQLCPTARHLAVYLLDLFMDHYDVAV 82

  Fly   222 TQLQILAAACLLLASKLREPSCRALSVDLL-----VVYTDNSIYKDDLIKWELYVLSRLGWDLSS 281
            .||.::|.:|||||||..|...|...::.|     :...:.::.|.||||.||.:|...||:|..
Zfish    83 RQLYVIALSCLLLASKFEEKEDRVPKLEQLNTLGFMCSLNLTLNKRDLIKMELLLLETFGWNLCM 147

  Fly   282 VTPLDFLE-LLMMRLPIGS--KNFPDINIGKVRG----HAQAFISLAAKEHKFAKFSASTIAASS 339
            .||..|:: .|...:..|.  ..:|..::.|.:.    :...|:.::.::|.|..|..|.:||:.
Zfish   148 PTPAHFIDYYLHAAVQEGDLHNGWPLSSLSKTKAFMDKYTHYFLEVSLQDHAFLSFRPSQVAAAC 212

  Fly   340 IAASMNGLK----W----HLRSGHNLHFL---LSLMTDLTSVEQAQVRDCMLHMEDIFKEHSR-- 391
            ||||...|:    |    ||.:|::...|   :.||             .:.|..|: ||.::  
Zfish   213 IAASRICLQISPSWTTVLHLLTGYSWDHLTQCIQLM-------------LLAHDNDV-KEANKSK 263

  Fly   392 -------NLEPFLVNIDPKEMSTLYYKRRFQIHQSQHLSQISIRPLPLPKAP--------AEC-- 439
                   :|:| ..::.|...:...:::.....| |.|.|.|..|.....:|        |:|  
Zfish   264 SSPSAGQSLQP-QAHVPPSTAAPSLHRQPTSSSQ-QLLLQASSYPQLSQHSPALSQLHMLADCQA 326

  Fly   440 -----VEQHQQQHNFG 450
                 ..::.|.|..|
Zfish   327 LGPVGSREYLQPHQAG 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycDNP_523355.2 Cyclin_N 155..280 CDD:278560 38/127 (30%)
Cyclin_C 282..>392 CDD:281044 30/136 (22%)
ccnjlNP_001296774.1 Cyclin_N 18..146 CDD:278560 38/127 (30%)
Cyclin_C 148..>254 CDD:281044 27/118 (23%)
STAT6_C 255..>344 CDD:291272 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.