DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15916 and Rbfa

DIOPT Version :9

Sequence 1:NP_573088.1 Gene:CG15916 / 32549 FlyBaseID:FBgn0030704 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006255013.1 Gene:Rbfa / 307235 RGDID:1311910 Length:345 Species:Rattus norvegicus


Alignment Length:264 Identity:67/264 - (25%)
Similarity:106/264 - (40%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SIRVLRLQNGHSVLNNACQLALSRNKSSKRSSKDNVTRQGKIFGSLFGNRLKGSKSHWYPSPDAG 67
            |.|...|.:....|:.:.....|:|...|.:||   ||                |..||.:|..|
  Rat    21 SYRAALLPSSSLALHTSVTSCGSKNLLKKFASK---TR----------------KKFWYEAPSLG 66

  Fly    68 TSGNQKSLHALKFGTPHS-KTTCSHNNRRMSVLNKLFMTNITDILATGAVADSIVGHGVQISYVK 131
            :....|. ...:|.|.:: |.|...:..|:.|||.|...::|::|.|..|:..:....|::|.|.
  Rat    67 SHLTHKP-SKYEFLTKNTLKKTRKEDTIRLRVLNGLLHKSLTELLCTPEVSQEVYDLNVELSKVS 130

  Fly   132 ITSDFSRINVYW-MGKDGGENQELENTLNRMSGKLQHELSQLHLMGEVPKIKFVRDKTSTGLHQV 195
            :|.|||...||| .|....:|:..|..|.|.:..::|.|.....:..||.|.||:||....|.:|
  Rat   131 VTPDFSACRVYWKTGVSAEQNRHTEAVLQRSATYMRHLLISQQTLRNVPPIVFVQDKRDIVLAEV 195

  Fly   196 HEVLSKIDLQHSYSSSNAEVEESD------AQSCQTAADEEWPEMRQDFLSFNHSLVMDKILGKM 254
            ..:|:..|.        ...:|.|      :...|...|...|....:....:|..:..:|:...
  Rat   196 DRLLAVADF--------GPPDERDDLDGLRSPDAQAPHDSPEPTTHPNLCGIDHEALNKQIMEYK 252

  Fly   255 RKSK 258
            ||.:
  Rat   253 RKKE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15916NP_573088.1 RBFA 95..188 CDD:280249 32/93 (34%)
RbfaXP_006255013.1 RBFA 94..187 CDD:280249 31/92 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354161
Domainoid 1 1.000 57 1.000 Domainoid score I10656
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5175
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420734at2759
OrthoFinder 1 1.000 - - FOG0007189
OrthoInspector 1 1.000 - - oto98708
orthoMCL 1 0.900 - - OOG6_109695
Panther 1 1.100 - - LDO PTHR14725
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6066
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.