DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15916 and C25G4.3

DIOPT Version :9

Sequence 1:NP_573088.1 Gene:CG15916 / 32549 FlyBaseID:FBgn0030704 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001255644.1 Gene:C25G4.3 / 178195 WormBaseID:WBGene00007731 Length:227 Species:Caenorhabditis elegans


Alignment Length:160 Identity:34/160 - (21%)
Similarity:79/160 - (49%) Gaps:24/160 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 GNQKSLHALKFGTPHSKTTCSHNNRRMSVLNKLFMTNITDILATGAVADSIVGH-GVQISYVKIT 133
            |.:..|..:..||...:.    :::::..|:::....|.:::||    |.::|. .:||:.|::.
 Worm    64 GLEDRLLLVSLGTKQRRL----DDKKVVQLSRILEERIAEVVAT----DEMLGRLQLQITRVRVD 120

  Fly   134 SDFSRINVYWMGKDGGENQ---ELENTLNRMSGKLQHELSQLHLMGEVPKIKFVRDKTSTGLHQV 195
            ..|::::||||.:..|:::   .||.:.:::..:::..:..     ..|::||:.||......::
 Worm   121 RAFTQVSVYWMCRGDGDSEIVDFLEESKHQIRRRVEESIGI-----TCPEVKFIGDKALLMEQEM 180

  Fly   196 HEVLSKIDLQHSYS--SSNAEV-----EES 218
            .::..:.|....|.  |.:|.|     |||
 Worm   181 DKLFREADYGMDYRLLSKSARVLGNVKEES 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15916NP_573088.1 RBFA 95..188 CDD:280249 21/96 (22%)
C25G4.3NP_001255644.1 RBFA 77..174 CDD:280249 22/109 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007189
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109695
Panther 1 1.100 - - LDO PTHR14725
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.