DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and MSBP1

DIOPT Version :10

Sequence 1:NP_573087.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_200037.1 Gene:MSBP1 / 835300 AraportID:AT5G52240 Length:220 Species:Arabidopsis thaliana


Alignment Length:211 Identity:70/211 - (33%)
Similarity:109/211 - (51%) Gaps:19/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LGNIIREILY-----SPMNLALLAIICFLVYKIVRDRTEVP---------SVGVAKPSEPELPKI 79
            |...::|.::     ||:.......:.|.:|:::......|         :..:|:..||.:|:.
plant     5 LWQTLKEAIHAYTGLSPVVFFTALALAFAIYQVISGWFASPFDDVNRHQRARSLAQEEEPPIPQP 69

  Fly    80 RR--DFTVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSVV 142
            .:  :.|.:||:||||:.|...:|:|:...:|||::.|.|||||||||.|||:||||.||..|..
plant    70 VQVGEITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFE 134

  Fly   143 SIDKDEYDDLSDLSAVEMDSVREWEMQFKEKYELVGKLLRKGEEPTNYDDDEDEENVNNDEQERK 207
              :||...|:|.|...|:|::::||.:|..||..||.:...|.||......|..|||..|.....
plant   135 --EKDLTWDVSGLGPFELDALQDWEYKFMSKYAKVGTVKVAGSEPETASVSEPTENVEQDAHVTT 197

  Fly   208 NLPKSKTE-TDDTKQE 222
            ...|:..: :||...|
plant   198 TPGKTVVDKSDDAPAE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_573087.1 Cyt-b5 84..152 CDD:459698 35/67 (52%)
MSBP1NP_200037.1 Cyt-b5 76..138 CDD:459698 34/63 (54%)

Return to query results.
Submit another query.