DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and MAPR3

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_190458.1 Gene:MAPR3 / 824050 AraportID:AT3G48890 Length:233 Species:Arabidopsis thaliana


Alignment Length:240 Identity:79/240 - (32%)
Similarity:118/240 - (49%) Gaps:39/240 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KEIGNNLNNDDSSFLGNIIREILYSPMNLALLAIICFLVYKIVRDRTEVP------SVGVAKPSE 73
            ::|...|....:::.|       .||.....:..:.|.||::|......|      |:.|...||
plant     3 QQIWETLKETITAYTG-------LSPAAFFTVLALAFAVYQVVSGFFVSPEVHRPRSLEVQPQSE 60

  Fly    74 PELPKIR-RDFTVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLA 137
            |..|.:: .:.|.:||:.|||:.....:|:|:.|.:||||:.|.|||||||||.|||:||||.||
plant    61 PLPPPVQLGEITEEELKLYDGSDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALA 125

  Fly   138 TFSVVSIDKDEYDDLSDLSAVEMDSVREWEMQFKEKYELVGKLLRK-GE-----EP--------- 187
            ..|..  |:|...|:|.|.|.|::::::||.:|..||..||.:.:| ||     ||         
plant   126 KMSFE--DQDLTGDISGLGAFELEALQDWEYKFMSKYVKVGTIQKKDGEGKESSEPSEAKTASAE 188

  Fly   188 ---TNYDDD-----EDEENVNNDEQERKNLPKSKTETDDTKQEKE 224
               ||..::     .||.:.:..|:..:...|....|||....||
plant   189 GLSTNTGEEASAITHDETSRSTGEKIAETTEKKDVATDDDDAAKE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 47/97 (48%)
MAPR3NP_190458.1 Cyt-b5 72..>133 CDD:395121 34/62 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I3231
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I2046
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331617at2759
OrthoFinder 1 1.000 - - FOG0001870
OrthoInspector 1 1.000 - - otm3553
orthoMCL 1 0.900 - - OOG6_100542
Panther 1 1.100 - - O PTHR10281
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1226
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.