DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and MAPR2

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001318286.1 Gene:MAPR2 / 817032 AraportID:AT2G24940 Length:100 Species:Arabidopsis thaliana


Alignment Length:103 Identity:42/103 - (40%)
Similarity:66/103 - (64%) Gaps:8/103 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 DFTVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSVVSIDK 146
            :||.::|.||:||.....:.||:.|.|:||:.|:.|||.||.|:.|||:||||.|...|     |
plant     2 EFTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMS-----K 61

  Fly   147 DEYD---DLSDLSAVEMDSVREWEMQFKEKYELVGKLL 181
            :|.|   .|..|:..|::::.:||.:|:.||.:||:::
plant    62 NEEDVSPSLEGLTEKEINTLNDWETKFEAKYPVVGRVV 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 42/100 (42%)
MAPR2NP_001318286.1 Cyt-b5 4..66 CDD:395121 30/66 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3553
orthoMCL 1 0.900 - - OOG6_100542
Panther 1 1.100 - - O PTHR10281
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.