DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and cyb5d2

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001096144.1 Gene:cyb5d2 / 795950 ZFINID:ZDB-GENE-050506-83 Length:267 Species:Danio rerio


Alignment Length:112 Identity:38/112 - (33%)
Similarity:61/112 - (54%) Gaps:6/112 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLAT--FSVVSIDK 146
            |.::|..|:|.:....:.:|:.|.|:||.|||:.|||||.|..|.|:||||...|  |:...:. 
Zfish    55 TKEQLSLYNGGKNSKGLYLAILGQVFDVEKGRKHYGPGGGYHFFTGKDASRAFITGDFTEAGLS- 118

  Fly   147 DEYDDLSDLSAVEMDSVREWEMQFKEKYELVGKLLRKGEEPTNYDDD 193
               :|:||.|..::.::.:|...::..|..||||:.:....|....|
Zfish   119 ---NDVSDFSESQIVALYDWLSFYQRDYTPVGKLIGRFYTETGQPTD 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 34/97 (35%)
cyb5d2NP_001096144.1 Cyt-b5 55..124 CDD:278597 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.