DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and nenf

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001032793.2 Gene:nenf / 571299 ZFINID:ZDB-GENE-050320-129 Length:158 Species:Danio rerio


Alignment Length:121 Identity:38/121 - (31%)
Similarity:66/121 - (54%) Gaps:7/121 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RDFTVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSVVSID 145
            |.||.:||::|||::....:.:|:.|.|:||:.|:.||..|.||....|:|::|.:|..|:...|
Zfish    31 RLFTDEELQRYDGSEDGQPIYMAIKGVVFDVTTGKEFYKKGAPYNALVGKDSTRAVAKMSLDPAD 95

  Fly   146 KDEYDDLSDLSAVEMDSVRE-WEMQFKEKYELVG----KLLRKGEEPTNYDDDEDE 196
            ...  |.:.|:..::.|:.: :...:|.||.:||    :||.:...|......||:
Zfish    96 LTH--DTTGLTESQLQSLEKIFTGTYKTKYPVVGYTSRRLLNEDGSPNKDFKPEDQ 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 32/102 (31%)
nenfNP_001032793.2 Cyt-b5 32..>87 CDD:278597 21/54 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100542
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.