DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and pgrmc1

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001007393.1 Gene:pgrmc1 / 492520 ZFINID:ZDB-GENE-041114-91 Length:179 Species:Danio rerio


Alignment Length:174 Identity:88/174 - (50%)
Similarity:128/174 - (73%) Gaps:9/174 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IIREILYSPMNLALLAIICFLVYKIVRDRTEVPS-VGVAKPSEPELPKI-RRDFTVKELRQYDGT 94
            |::||..||:|::||.:..||:|||:|.  :.|: .|   |.|..|||: :||||:.:|::|||.
Zfish    12 ILQEIFTSPLNISLLCLCLFLLYKIIRG--DKPADYG---PVEEPLPKLKKRDFTLADLQEYDGL 71

  Fly    95 QPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSV-VSIDKDEYDDLSDLSAV 158
            : :.|:|:||||.|:||::|::||||.|||..|||:||||.||||.: ....||.:||||||:|:
Zfish    72 K-NPRILMAVNGKVFDVTRGKKFYGPEGPYGVFAGKDASRGLATFCLEKEALKDTHDDLSDLNAM 135

  Fly   159 EMDSVREWEMQFKEKYELVGKLLRKGEEPTNYDDDEDEENVNND 202
            :.:|:.|||.||.:||:.:||||:.|||||.|.|||:.::...|
Zfish   136 QQESLSEWETQFTQKYDYIGKLLKPGEEPTEYTDDEEVKDKKKD 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 53/98 (54%)
pgrmc1NP_001007393.1 Cyt-b5 59..157 CDD:278597 53/98 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583800
Domainoid 1 1.000 79 1.000 Domainoid score I8621
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48457
Inparanoid 1 1.050 171 1.000 Inparanoid score I4091
OMA 1 1.010 - - QHG48262
OrthoDB 1 1.010 - - D1331617at2759
OrthoFinder 1 1.000 - - FOG0001870
OrthoInspector 1 1.000 - - otm24454
orthoMCL 1 0.900 - - OOG6_100542
Panther 1 1.100 - - O PTHR10281
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R288
SonicParanoid 1 1.000 - - X1226
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.