DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and pgrmc1

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001006842.1 Gene:pgrmc1 / 448590 XenbaseID:XB-GENE-6082492 Length:177 Species:Xenopus tropicalis


Alignment Length:183 Identity:90/183 - (49%)
Similarity:130/183 - (71%) Gaps:17/183 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IIREILYSPMNLALLAIICFLVYKIVR-DRTEVPSVGVAKPSEPELPKI-RRDFTVKELRQYDGT 94
            |::||..||:|:.||.:..:|:|||:| |:.:     ..:.:|.:|||: |||||..||::|||.
 Frog     6 ILQEIFTSPLNICLLCLCLYLLYKILRGDKPQ-----TTENNEEQLPKMKRRDFTPAELKEYDGV 65

  Fly    95 QPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSVVSID----KDEYDDLSDL 155
            | :.|:|:|::|.|:||::|::||||.|||..||||||||.||||   .:|    ||.|||||||
 Frog    66 Q-NPRILMAISGKVFDVTRGKKFYGPEGPYGVFAGRDASRGLATF---CLDKEALKDTYDDLSDL 126

  Fly   156 SAVEMDSVREWEMQFKEKYELVGKLLRKGEEPTNYDDDEDEENVNNDEQERKN 208
            :|.:.:::.:||.||..||..|||||:.|||||.|.||||.::.:  :.::||
 Frog   127 TATQRETLSDWEAQFTFKYHHVGKLLKDGEEPTEYTDDEDAKDTS--DLKKKN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 55/101 (54%)
pgrmc1NP_001006842.1 Cyt-b5 55..118 CDD:395121 35/66 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8149
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48457
Inparanoid 1 1.050 169 1.000 Inparanoid score I4019
OMA 1 1.010 - - QHG48262
OrthoDB 1 1.010 - - D1331617at2759
OrthoFinder 1 1.000 - - FOG0001870
OrthoInspector 1 1.000 - - otm48112
Panther 1 1.100 - - O PTHR10281
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1226
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.