DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and pgrmc2

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_002932101.3 Gene:pgrmc2 / 394928 XenbaseID:XB-GENE-981038 Length:296 Species:Xenopus tropicalis


Alignment Length:200 Identity:95/200 - (47%)
Similarity:128/200 - (64%) Gaps:40/200 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLGNIIREILYSPMNLALLAIICFLVYKIVRDRTEVPSVGVAKPSEPELPKI-RRDFTVKELRQY 91
            |.|.::       :|.||:.::.:..::|........|.|||     .||:: |||||:::|::|
 Frog   132 FAGELL-------LNAALVLVVVYGAFRIYLRWKGSGSGGVA-----SLPRMKRRDFTLQQLQEY 184

  Fly    92 DGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSVVSIDK----DEYDDL 152
            |||: :.|:|:||||.|:||::|.:||||.|||..||||||||.||||   .:||    ||||||
 Frog   185 DGTR-NPRILLAVNGKVFDVTQGSKFYGPDGPYGLFAGRDASRGLATF---CLDKEALRDEYDDL 245

  Fly   153 SDLSAVEMDSVREWEMQFKEKYELVGKLLRKGEEPTNYDDDEDEENVNNDEQERKNLPKSKTETD 217
            |||:||:|:||||||||||||||.||:||:.||||:.|.|:||..                   |
 Frog   246 SDLNAVQMESVREWEMQFKEKYEYVGRLLKPGEEPSEYTDEEDVR-------------------D 291

  Fly   218 DTKQE 222
            .|||:
 Frog   292 HTKQD 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 67/101 (66%)
pgrmc2XP_002932101.3 Cyt-b5 177..240 CDD:395121 37/66 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8149
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 169 1.000 Inparanoid score I4019
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331617at2759
OrthoFinder 1 1.000 - - FOG0001870
OrthoInspector 1 1.000 - - otm48112
Panther 1 1.100 - - LDO PTHR10281
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1226
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.