DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and Pgrmc2

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001008375.1 Gene:Pgrmc2 / 361940 RGDID:1308804 Length:217 Species:Rattus norvegicus


Alignment Length:168 Identity:89/168 - (52%)
Similarity:121/168 - (72%) Gaps:15/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MNLALLAIICFLVYKI-----VRDRTEVPSVGVAKPSEPELPKI-RRDFTVKELRQYDGTQPDGR 99
            :|:||:|::....|::     .|.....|..|...|: ..||:: :|||::::||||||.:.. |
  Rat    50 LNVALVALVLLGAYRLWVRWGRRGLCSGPGAGEESPA-ATLPRMKKRDFSLEQLRQYDGARTP-R 112

  Fly   100 VLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSVVSIDK----DEYDDLSDLSAVEM 160
            :|:||||.|:||:||.:||||.|||..||||||||.||||   .:||    |||||||||:||:|
  Rat   113 ILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATF---CLDKDALRDEYDDLSDLNAVQM 174

  Fly   161 DSVREWEMQFKEKYELVGKLLRKGEEPTNYDDDEDEEN 198
            :|||||||||||||:.||:||:.||||:.|.|:||.::
  Rat   175 ESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 67/101 (66%)
Pgrmc2NP_001008375.1 Cyt-b5 98..161 CDD:395121 38/66 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..217 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343541
Domainoid 1 1.000 91 1.000 Domainoid score I7528
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3923
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331617at2759
OrthoFinder 1 1.000 - - FOG0001870
OrthoInspector 1 1.000 - - otm45052
orthoMCL 1 0.900 - - OOG6_100542
Panther 1 1.100 - - LDO PTHR10281
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1226
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.