DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and CG16957

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001285897.1 Gene:CG16957 / 34755 FlyBaseID:FBgn0032519 Length:192 Species:Drosophila melanogaster


Alignment Length:173 Identity:71/173 - (41%)
Similarity:105/173 - (60%) Gaps:11/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LGNIIREILYSPMNLALL--AIICFLVYKIVRDR--TEVPSVGVAKPSEPELPKIRRDFTVKELR 89
            |.|.::|   :|:::.||  :|:.||.......|  .|.|........|.:||.:|:||||:|||
  Fly    18 LYNSLKE---TPIDVTLLIMSIVVFLKLGFFARRLSREEPDFSDDNNQEVDLPPLRKDFTVRELR 79

  Fly    90 QYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSVVSIDKDEYDDLSD 154
            :||||:.|||:|||:..::||||:...:||..|....:||||.||.|........|.:::|||||
  Fly    80 EYDGTRADGRILVAILFNIYDVSRSVHYYGRNGVNPNYAGRDISRILINSPEDLKDSEDFDDLSD 144

  Fly   155 LSAVEMDSVREWEMQFKEKYELVGKLLRKGEEPTNYDDDEDEE 197
            ||..:|:::||||.::|.||..||||    :|....:::||.|
  Fly   145 LSRNQMNTLREWEQRYKMKYPFVGKL----KEKLQINEEEDFE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 49/97 (51%)
CG16957NP_001285897.1 Cyt-b5 72..170 CDD:278597 49/97 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464260
Domainoid 1 1.000 65 1.000 Domainoid score I6620
eggNOG 1 0.900 - - E1_KOG1110
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I1642
Isobase 1 0.950 - 0 Normalized mean entropy S1266
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331617at2759
OrthoFinder 1 1.000 - - FOG0001870
OrthoInspector 1 1.000 - - otm3553
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10281
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1226
1110.850

Return to query results.
Submit another query.