DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and Tango5

DIOPT Version :10

Sequence 1:NP_573087.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_727444.1 Gene:Tango5 / 326232 FlyBaseID:FBgn0052675 Length:530 Species:Drosophila melanogaster


Alignment Length:60 Identity:14/60 - (23%)
Similarity:25/60 - (41%) Gaps:16/60 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 WEMQFKEKYE--------LVGKL----LRKGEEPTNYDDDEDEE----NVNNDEQERKNL 209
            |.:..|.:.|        .:|:|    :.|....:.||.::.||    ...|.::.:|||
  Fly   276 WSIMSKVRLEAFLWGAGTALGELPPYFMAKAARLSGYDPEDAEELAEFEALNAKRHQKNL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_573087.1 Cyt-b5 84..152 CDD:459698
Tango5NP_727444.1 SNARE_assoc <346..395 CDD:469768
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.