DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and t-cup

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_723757.1 Gene:t-cup / 318986 FlyBaseID:FBgn0051858 Length:216 Species:Drosophila melanogaster


Alignment Length:208 Identity:56/208 - (26%)
Similarity:98/208 - (47%) Gaps:31/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLGNIIREILYSPMNLALLAIICFLVYKIVRDRTEVPSVGVAKPSEPELPKIRRDFTVKELRQYD 92
            |..||:..:|.|    .|:.:..:..|.:..:|.|:....:...:.|:||.|:  ..:.:|..:|
  Fly    10 FTVNIVLTVLAS----VLVYLYAYWHYYVNEERNELTVSKLLATNLPDLPPIK--LNLDQLLGFD 68

  Fly    93 GTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSVVSIDKDEYDDLSDLSA 157
            ||:.|||:|||:.|.:||||.....:|..|..:..||||.:..|.:             :.|...
  Fly    69 GTRSDGRILVALRGKIYDVSSDFEEFGLTGTLSHVAGRDFTNYLKS-------------IMDTHN 120

  Fly   158 VEMDSVREWEMQFKEKYELVGKLLRKGEEP-----TNYDDD---EDEEN----VNNDEQERKNLP 210
            .|::.|..||...:..|..||:::.:...|     .|:|.|   |.||:    :..:|:..|::.
  Fly   121 SEINYVDRWESILETNYSCVGEVIDEQGNPLMGKIENHDVDVMEETEEDMIEPIKANEKSMKSVL 185

  Fly   211 KSKTETDDTKQEK 223
            .::|...:||.:|
  Fly   186 TAETLPSETKSQK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 30/97 (31%)
t-cupNP_723757.1 Cyt-b5 72..143 CDD:278597 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331617at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10281
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.