DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and Cyb5d2

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001007672.1 Gene:Cyb5d2 / 303293 RGDID:1359124 Length:263 Species:Rattus norvegicus


Alignment Length:157 Identity:54/157 - (34%)
Similarity:82/157 - (52%) Gaps:19/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 PKIRRDFTVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLAT--F 139
            |.||. |..:||.:|.|...|..:.:|:.|.|||||.||:.|.||..|:.||||||||...|  :
  Rat    33 PSIRL-FVPEELARYRGGPGDPGLYLALLGRVYDVSSGRKHYEPGAHYSGFAGRDASRAFVTGDY 96

  Fly   140 SVVSIDKDEYDDLSDLSAVEMDSVREWEMQFKEKYELVGKLLRK--GEE--PTNYDDDEDEENV- 199
            |...:    .||::.||:.|:.::..|...:::.|..||:|:.:  |::  ||: :..:.|..| 
  Rat    97 SEAGL----VDDVNGLSSSEILTLHNWLSFYEKNYVFVGRLIGRFYGKDGLPTS-ELTQVEAMVT 156

  Fly   200 -----NNDEQ-ERKNLPKSKTETDDTK 220
                 |..|| |::..|....|....|
  Rat   157 KGMEANEQEQREKQRFPPCNAEWSSAK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 38/99 (38%)
Cyb5d2NP_001007672.1 Cyt-b5 37..>91 CDD:278597 27/54 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..247
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.