DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and NENF

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_037481.1 Gene:NENF / 29937 HGNCID:30384 Length:172 Species:Homo sapiens


Alignment Length:172 Identity:51/172 - (29%)
Similarity:87/172 - (50%) Gaps:25/172 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LALLAIICFLVYKIVRDRTEVPSVGVAKPSEPELPKIR----RDFTVKELRQYDGTQPDGRVLVA 103
            ||.||::..|          .|.:..|:..:...|..|    |.||.:||.:|.|.:.|..:.:|
Human    13 LAALALVLAL----------APGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLA 67

  Fly   104 VNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSVVSIDKDEYDDLSDLSAVEMDSVRE-WE 167
            |.|.|:||:.|:.|||.|.||....|:|::|.:|..|:...|...  |.:.|:|.|::::.| :.
Human    68 VKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTH--DTTGLTAKELEALDEVFT 130

  Fly   168 MQFKEKYELVG----KLLRKGEEPTNYD---DDEDEENVNND 202
            ..:|.||.:||    ::|.:...| |.|   :|:...::.::
Human   131 KVYKAKYPIVGYTARRILNEDGSP-NLDFKPEDQPHFDIKDE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 36/102 (35%)
NENFNP_037481.1 Cyt-b5 48..>109 CDD:365921 24/60 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..172 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100542
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.