DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and Pgrmc1

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_068534.2 Gene:Pgrmc1 / 291948 RGDID:70890 Length:195 Species:Rattus norvegicus


Alignment Length:208 Identity:101/208 - (48%)
Similarity:130/208 - (62%) Gaps:28/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GADPSSAYDKEIGNNLNNDDSSFLGNIIREILYSPMNLALLAIICFLVYKIVRDRTEVPSVGVAK 70
            |||||....               |.:::||..||:||.||.:..||:|||||......|.....
  Rat    10 GADPSELEG---------------GGLLQEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDD 59

  Fly    71 PSEPELPKIR-RDFTVKELRQYDGTQPDGRVLVAVNGSVYDVSKGRRFYGPGGPYATFAGRDASR 134
            ...|.||::: ||||..|||:|||.| |.|:|:|:||.|:||:|||:||||.|||..||||||||
  Rat    60 DEPPPLPRLKPRDFTPAELRRYDGVQ-DPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR 123

  Fly   135 NLATFSVVSID----KDEYDDLSDLSAVEMDSVREWEMQFKEKYELVGKLLRKGEEPTNYDDDED 195
            .||||   .:|    ||||||||||:..:.:::.:|:.||..||..|||||::|||||.|.|||:
  Rat   124 GLATF---CLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEE 185

  Fly   196 EENVNNDEQERKN 208
            .:    ||..||:
  Rat   186 PK----DEAARKS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 59/101 (58%)
Pgrmc1NP_068534.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..72 4/20 (20%)
Cyt-b5 74..137 CDD:395121 40/66 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..195 13/26 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343543
Domainoid 1 1.000 91 1.000 Domainoid score I7528
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48457
Inparanoid 1 1.050 178 1.000 Inparanoid score I3923
OMA 1 1.010 - - QHG48262
OrthoDB 1 1.010 - - D1331617at2759
OrthoFinder 1 1.000 - - FOG0001870
OrthoInspector 1 1.000 - - otm45052
orthoMCL 1 0.900 - - OOG6_100542
Panther 1 1.100 - - O PTHR10281
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1226
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.