DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSBP and vem-1

DIOPT Version :9

Sequence 1:NP_001162765.1 Gene:MSBP / 32548 FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001024770.1 Gene:vem-1 / 181066 WormBaseID:WBGene00006890 Length:183 Species:Caenorhabditis elegans


Alignment Length:173 Identity:61/173 - (35%)
Similarity:97/173 - (56%) Gaps:16/173 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LLAIICFLVYKIVRDRTEVPSVGVAKPSEPELPKIRRDFTVKELRQYDGTQPDGRVLVAVNGSVY 109
            |:.::.|..|.:.|....:|:     |.:...|....|.||:|||:|||.:.: .:|..:||::|
 Worm    17 LVVVLGFFFYWLTRSEQPLPA-----PPKELAPLPMSDMTVEELRKYDGVKNE-HILFGLNGTIY 75

  Fly   110 DVSKGRRFYGPGGPYATFAGRDASRNLATFSVVSIDKDEYDDLSDLSAVEMDSVREWEMQFKEKY 174
            ||::|:.|||||..|.|.||.||:|.|.|....:: ..|:||.:.:||.|.::..|||.|||.||
 Worm    76 DVTRGKGFYGPGKAYGTLAGHDATRALGTMDQNAV-SSEWDDHTGISADEQETANEWETQFKFKY 139

  Fly   175 ELVGKLLRKGEEPTNYDD-------DEDEENVNN--DEQERKN 208
            ..||:|::...|..:|.:       .|..:::.|  ||..:|:
 Worm   140 LTVGRLVKNSSEKADYGNRKSFVRGAESLDSIINGGDEGTKKD 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 46/97 (47%)
vem-1NP_001024770.1 Cyt-b5 51..>106 CDD:306642 29/55 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164624
Domainoid 1 1.000 65 1.000 Domainoid score I6620
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48457
Inparanoid 1 1.050 108 1.000 Inparanoid score I3485
Isobase 1 0.950 - 0 Normalized mean entropy S1266
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331617at2759
OrthoFinder 1 1.000 - - FOG0001870
OrthoInspector 1 1.000 - - otm14576
orthoMCL 1 0.900 - - OOG6_100542
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R288
SonicParanoid 1 1.000 - - X1226
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.780

Return to query results.
Submit another query.