DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gapdh2 and GAPB

DIOPT Version :9

Sequence 1:NP_001259584.1 Gene:Gapdh2 / 32545 FlyBaseID:FBgn0001092 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_174996.1 Gene:GAPB / 840895 AraportID:AT1G42970 Length:447 Species:Arabidopsis thaliana


Alignment Length:337 Identity:158/337 - (46%)
Similarity:208/337 - (61%) Gaps:10/337 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIGINGFGRIGRLVLR---AAIDKGANVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTV-AAEGGF 63
            |:.|||||||||..||   ...|....||.:||.. .|....:|.|:||..|.||..| ..:...
plant    83 KVAINGFGRIGRNFLRCWHGRKDSPLEVVVLNDSG-GVKNASHLLKYDSMLGTFKAEVKIVDNET 146

  Fly    64 LVVNGQKITVFSERDPANINWASAGAEYIVESTGVFTTIDKASTHLKGGAKKVIISAPS--ADAP 126
            :.|:|:.|.|.|.|||..:.||..|.:.::|.||||.....|..|::.||.||||:||:  ||.|
plant   147 ISVDGKLIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIP 211

  Fly   127 MFVCGVNLDAYKPDM-KVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSG 190
            .:|.|||...|..|: .::||||||||||||.|||:::.|.||:|.|||.|:.|..|:.:|....
plant   212 TYVMGVNEQDYGHDVANIISNASCTTNCLAPFAKVLDEEFGIVKGTMTTTHSYTGDQRLLDASHR 276

  Fly   191 KLWRDGRGAAQNIIPASTGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRL-GKGASYDE 254
            .| |..|.||.||:|.||||||||..|:|.|.|||.|:|.||||||||||||.:.: .||.:.::
plant   277 DL-RRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVINVEKKGLTAED 340

  Fly   255 IKAKVQEAANGPLKGILGYTDEEVVSTDFLSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSN 319
            :....::|||||:||||...|..:||.||.....|:..|:...:.:.|..||:::|||||:|||.
plant   341 VNEAFRKAANGPMKGILDVCDAPLVSVDFRCSDVSTTIDSSLTMVMGDDMVKVVAWYDNEWGYSQ 405

  Fly   320 RVIDLIKYMQSK 331
            ||:||...:.||
plant   406 RVVDLAHLVASK 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gapdh2NP_001259584.1 PLN02272 <2..328 CDD:177912 156/332 (47%)
GAPBNP_174996.1 PLN02237 3..447 CDD:215131 158/337 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0057
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53863
OrthoDB 1 1.010 - - D945145at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100218
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.690

Return to query results.
Submit another query.