DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gapdh2 and gapdh

DIOPT Version :9

Sequence 1:NP_001259584.1 Gene:Gapdh2 / 32545 FlyBaseID:FBgn0001092 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_012821840.1 Gene:gapdh / 448356 XenbaseID:XB-GENE-487820 Length:334 Species:Xenopus tropicalis


Alignment Length:331 Identity:255/331 - (77%)
Similarity:286/331 - (86%) Gaps:1/331 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIGINGFGRIGRLVLRAAIDKG-ANVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVV 66
            ||||||||||||||.|||:..| ..|||:||||||::||.|:||:|||||||||||..|.|.||:
 Frog     4 KIGINGFGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVI 68

  Fly    67 NGQKITVFSERDPANINWASAGAEYIVESTGVFTTIDKASTHLKGGAKKVIISAPSADAPMFVCG 131
            ||:.:|||.||||:||.|..|||.|:|||||||||.:||..|||||||:||||||||||||||.|
 Frog    69 NGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGGAKRVIISAPSADAPMFVVG 133

  Fly   132 VNLDAYKPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDG 196
            ||.|.|...:.|||||||||||||||||||||||.|:|||||||||.||||||||||||||||||
 Frog   134 VNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDG 198

  Fly   197 RGAAQNIIPASTGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGASYDEIKAKVQE 261
            |||.|||||||||||||||||||.|||||||||||||||||||||||.||.|.|.||:|||.::.
 Frog   199 RGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKT 263

  Fly   262 AANGPLKGILGYTDEEVVSTDFLSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIK 326
            ||:||:||||.||:::||||||..|||||:|||.|||:|||.||||:||||||.|||:||:||:.
 Frog   264 AAHGPMKGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMC 328

  Fly   327 YMQSKD 332
            :|.||:
 Frog   329 HMASKE 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gapdh2NP_001259584.1 PLN02272 <2..328 CDD:177912 252/325 (78%)
gapdhXP_012821840.1 PLN02272 <3..331 CDD:177912 252/326 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 265 1.000 Domainoid score I1863
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H107053
Inparanoid 1 1.050 515 1.000 Inparanoid score I1269
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D394372at33208
OrthoFinder 1 1.000 - - FOG0000254
OrthoInspector 1 1.000 - - otm48295
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R464
SonicParanoid 1 1.000 - - X175
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.