DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and CEF1

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_013940.1 Gene:CEF1 / 855253 SGDID:S000004826 Length:590 Species:Saccharomyces cerevisiae


Alignment Length:473 Identity:90/473 - (19%)
Similarity:158/473 - (33%) Gaps:152/473 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PELIK-GPWTRDEDDMVIKLVRNFGPKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKE 195
            |..:| |.||..||.::...|:.:|..:|:.:|..|..:..:|...||:.:|||.:..|.::::|
Yeast     5 PIYVKGGVWTNVEDQILKAAVQKYGTHQWSKVASLLQKKTARQSELRWNEYLNPKLNFTEFSKEE 69

  Fly   196 DEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLIT 260
            |..:.....||.|||..||..:.......::         :|:....|.::.|:.|.:.    :|
Yeast    70 DAQLLDLARELPNQWRTIADMMARPAQVCVE---------RYNRLLESEDSGGAALSTG----VT 121

  Fly   261 LIKSGGISKCMNNMQHNKESG----------GEAVNKSENADGASVTAVKGGDLAQESQDDHQKG 315
            .:|:|.|:..........::|          .||..:..|..|...|......:.:||:      
Yeast   122 DLKAGDINPNAETQMARPDNGDLEDEEKEMLAEARARLLNTQGKKATRKIRERMLEESK------ 180

  Fly   316 SNLAHLSMQHLIKLTMPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEEAAGNARSRPPSSPVI 380
             .:|.|..:..:|                       |||.:.:                      
Yeast   181 -RIAELQKRRELK-----------------------QAGINVA---------------------- 199

  Fly   381 SPIKSLPFSPSHFLKSPCLTTFEDMD-----LRASTPVTKVY--NRVGMEIKKEMETSSIETPHK 438
                         :|.|......|:|     :....|:..:|  :....:|||:.|....:...|
Yeast   200 -------------IKKPKKKYGTDIDYNEDIVYEQAPMPGIYDTSTEDRQIKKKFEQFERKVNRK 251

  Fly   439 SQLGPRTPTPFKKALAAIGKKRDGRRYEPSSPSSLVEDLAEIIHEEHLSNSLTANNSKMMGAADQ 503
            . |......|.|       |.:|.:|.                |:|        |......|..:
Yeast   252 G-LDGNKDKPSK-------KNKDKKRK----------------HDE--------NEHVEKAALGE 284

  Fly   504 NSTLSTEYNAQ----SPPHMKRARKSLLSTWSSNHPYNAGSAKRIQPFETETPSKFLTSPGDILK 564
            ::||:.||...    |.|..|:.:.:......|         ||.:..|.:.....|| |.::  
Yeast   285 STTLTDEYKKPKLILSAPGTKQGKVTYKKKLES---------KRQKLIEAQATGTVLT-PKEL-- 337

  Fly   565 DTLCSEQDLPFDEGRKEN 582
                    ||.|.|:::|
Yeast   338 --------LPHDSGQEDN 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 90/473 (19%)
Myb_DNA-bind_6 88..147 CDD:290632 7/15 (47%)
SANT 136..184 CDD:197842 15/48 (31%)
Myb_DNA-bind_6 139..197 CDD:290632 17/57 (30%)
SANT 188..235 CDD:197842 10/46 (22%)
Myb_DNA-binding 188..233 CDD:278669 10/44 (23%)
Cmyb_C 388..530 CDD:286408 28/152 (18%)
CEF1NP_013940.1 REB1 1..491 CDD:227476 90/473 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.