DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and REB1

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_009605.1 Gene:REB1 / 852338 SGDID:S000000253 Length:810 Species:Saccharomyces cerevisiae


Alignment Length:401 Identity:78/401 - (19%)
Similarity:146/401 - (36%) Gaps:112/401 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SASTENGEELMN--------YGSNSDSEESEYSENEDTQVCDKDSQQNSNADSGYPLDS------ 53
            :|.|::.|:|.:        :|.|..::    :.|:||......::|.|.......|||      
Yeast   274 AADTDDNEKLKHIKDHLMRTHGLNHQNK----NHNDDTDDLSNSTKQYSELQKDSMLDSSLNKSR 334

  Fly    54 ------PEL--QDSKTTGQKG---QNKSGKT----------------------SIGAVHPN---Y 82
                  |::  ||::...||.   .|::|..                      |..:..|:   .
Yeast   335 NYMEVLPKVISQDTQPHQQKSPSHDNEAGSVDNSEISQLLQSAATKASSLVSLSSSSATPSTSRS 399

  Fly    83 GFGKRWSKSEDVLLKQLVETHGENWEIIGPHFKDRL-EQQVQQR-WA-------------KVL-- 130
            ...|.:.|:||..|::.:    ..:|.|     :|| .|||.:| |:             |||  
Yeast   400 NNSKAFDKAEDAALERFI----NEYEAI-----ERLTRQQVCERIWSSDRPKDNFWNNIYKVLPY 455

  Fly   131 --NPELIK------------GPWTRDEDDMVIKLVRNFGPKKWTLIARYLNGRIGKQCRERWHNH 181
              :..:.|            |.||.:|:..:.||... ...:|..|.:.| ||:.:.||:||.|:
Yeast   456 RSSSSIYKHMRRKYHIFEQRGKWTAEEEQELAKLCAE-KEGQWAEIGKTL-GRMPEDCRDRWRNY 518

  Fly   182 L--NPNIKKTAWTEKEDEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSV 244
            :  ..|.....|:.:|:|::.:.          |:..|........:.|.|.....::.::....
Yeast   519 VKCGTNRASNRWSVEEEELLKKV----------ISDMLEEAQQQQSQLHPNLLEEEQHLLQDDQN 573

  Fly   245 NASGSDLKSSRTHLITLIKSGGISKCMNNMQHNKESGGEAVNKSENADGASVTAVKGGDLAQES- 308
            :...:|.....|.......:..|.:....:|..::...:|:..:..|..:|:...|..|...:| 
Yeast   574 DHRNNDEDDDDTASAAAAAAAAIQEQQQLLQQKQQDDDDAIAAAAAAASSSLGDNKDEDKPHDSL 638

  Fly   309 ---QDDHQKGS 316
               .||:.:.|
Yeast   639 GIQLDDNSQNS 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842 17/65 (26%)
Myb_DNA-bind_6 88..147 CDD:290632 21/89 (24%)
SANT 136..184 CDD:197842 17/61 (28%)
Myb_DNA-bind_6 139..197 CDD:290632 18/59 (31%)
SANT 188..235 CDD:197842 7/46 (15%)
Myb_DNA-binding 188..233 CDD:278669 7/44 (16%)
Cmyb_C 388..530 CDD:286408
REB1NP_009605.1 REB1 202..701 CDD:227476 78/401 (19%)
SANT <691..719 CDD:197842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344736
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2047
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.