DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB63

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_001321204.1 Gene:MYB63 / 844259 AraportID:AT1G79180 Length:327 Species:Arabidopsis thaliana


Alignment Length:391 Identity:91/391 - (23%)
Similarity:147/391 - (37%) Gaps:123/391 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KGPWTRDEDDMVIKLVRNFGPKKWT-------------------------LIARYLNG------- 168
            :|||:.:||..:|..::.||.:.|.                         |....||.       
plant    16 RGPWSPEEDIKLISFIQKFGHENWRSLPKQSGMSLLLSSQSKQKPLQLFFLFFMILNVYICKNEG 80

  Fly   169 --RIGKQCRERWHNHLNPNIKKTAWTEKEDEIIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNS 231
              |.||.||.||.|:|.|::|:..:|.:|:|.|.:.|...||:|:|||.:|||||||.|||.|::
plant    81 LLRCGKSCRLRWINYLRPDLKRGNFTSEEEETIIKLHHNYGNKWSKIASQLPGRTDNEIKNVWHT 145

  Fly   232 TMRRKYDVERRSVNASG-SDLKSSRTHLITLIKSGGISKCMNNMQHNKESGGEAVNKSENADGAS 295
            .::      :|...:|| :|..:|.      ..|..:|:..::...:.|   :::|:..|.....
plant   146 HLK------KRLAQSSGTADEPASP------CSSDSVSRGKDDKSSHVE---DSLNRETNHRNEL 195

  Fly   296 VTAVKGGDLAQESQDDHQKGSNLAHLSMQHLIKLTMPRQTPIILKRTRKHIPETHHQAGCSSSET 360
            .|::..|  ....|||                        |.|.:...::|.|.:.:        
plant   196 STSMSSG--GSNQQDD------------------------PKIDELRFEYIEEAYSE-------- 226

  Fly   361 FN----QEEAAGNARSRPPSSPVISP-IKSLPFSPSHFLKSPCLTTFEDMDLRASTPVTKVYNRV 420
            ||    ||              |..| :..:||.     ..|.:.:|.|..           |..
plant   227 FNDIIIQE--------------VDKPDLLEIPFD-----SDPDIWSFLDTS-----------NSF 261

  Fly   421 GMEIKKEMETSSIETPHKSQLGPRTPTPFKKALAAIGKKRDGR----RYEPSSPSSLVEDLAEII 481
            ......|..:.|..|..:..........||...:.:|.:.|..    :.|.||.|||:::...:|
plant   262 QQSTANENSSGSRATTEEESDEDEVKKWFKHLESELGLEEDDNQQQYKEEESSSSSLLKNYELMI 326

  Fly   482 H 482
            |
plant   327 H 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 5/10 (50%)
SANT 136..184 CDD:197842 21/81 (26%)
Myb_DNA-bind_6 139..197 CDD:290632 23/91 (25%)
SANT 188..235 CDD:197842 22/46 (48%)
Myb_DNA-binding 188..233 CDD:278669 22/44 (50%)
Cmyb_C 388..530 CDD:286408 20/99 (20%)
MYB63NP_001321204.1 PLN03091 4..>272 CDD:215570 77/334 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.