DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB122

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_177548.1 Gene:MYB122 / 843748 AraportID:AT1G74080 Length:333 Species:Arabidopsis thaliana


Alignment Length:412 Identity:94/412 - (22%)
Similarity:158/412 - (38%) Gaps:118/412 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 LIKGPWTRDEDDMVIKLVRNFGPKKW-TLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKEDE 197
            |.||.||::||..:|..|:..|...| ||..:....|.||.||.||.|:|.|:||:..:::.|::
plant    12 LKKGAWTQEEDQKLIAYVQRHGEGGWRTLPDKAGLKRCGKSCRLRWANYLRPDIKRGEFSQDEED 76

  Fly   198 IIYQAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITLI 262
            .|...|...||:|:.||:::|.||||.||||||:.:::                        .|:
plant    77 SIINLHAIHGNKWSAIARKIPRRTDNEIKNHWNTHIKK------------------------CLV 117

  Fly   263 KSGGISKCMNNMQHNK--ESGGEAVNKSENADGASVTAVKGGDLAQESQDDHQKGSNLAHLSMQH 325
            |.|     ::.:.|..  :..|::.:.|.:.:.:||         .:.:||  :.||...||   
plant   118 KKG-----IDPLTHKSLLDGAGKSSDHSAHPEKSSV---------HDDKDD--QNSNNKKLS--- 163

  Fly   326 LIKLTMPRQTPIILKRTRKHIPETHHQAGCSSSETFNQEEAAGNARSRPPSSPVISPIKSLPFSP 390
                                        |.||:...|:   ..|......:..|:|.|       
plant   164 ----------------------------GSSSARFLNR---VANRFGHRINHNVLSDI------- 190

  Fly   391 SHFLKSPCLTTFEDMDLRASTPVTKVYNRVGMEIKKEMETSSIETPHKSQLGPRTPTPFKKALAA 455
               :.|..|.|..      :||.|.|       .:.|..|||..|...|.|      |..:::..
plant   191 ---IGSNGLLTSH------TTPTTSV-------SEGERSTSSSSTHTSSNL------PINRSITV 233

  Fly   456 IGKKRDGRRYEPSSPSSLVEDLAEIIHEEHLSNSLTANNSKMMG--AADQNSTLSTEYNAQSPPH 518
            .........:..|....|.|::...|.:      :|..:|:.:.  .:.::..:|.|...::...
plant   234 DATSLSSSTFSDSPDPCLYEEIVGDIED------MTRFSSRCLSHVLSHEDLLMSVESCLENTSF 292

  Fly   519 MKRA----RKSLLSTWSSNHPY 536
            |:..    ::..:.|.|.|..|
plant   293 MREITMIFQEDKIETTSFNDSY 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 7/12 (58%)
SANT 136..184 CDD:197842 21/48 (44%)
Myb_DNA-bind_6 139..197 CDD:290632 23/58 (40%)
SANT 188..235 CDD:197842 19/46 (41%)
Myb_DNA-binding 188..233 CDD:278669 19/44 (43%)
Cmyb_C 388..530 CDD:286408 24/147 (16%)
MYB122NP_177548.1 SANT 14..63 CDD:197842 21/48 (44%)
Myb_DNA-binding 14..61 CDD:278669 20/46 (43%)
SANT 67..114 CDD:197842 19/46 (41%)
Myb_DNA-binding 67..112 CDD:278669 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.