DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Myb and MYB54

DIOPT Version :9

Sequence 1:NP_511170.1 Gene:Myb / 32543 FlyBaseID:FBgn0002914 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_177484.1 Gene:MYB54 / 843676 AraportID:AT1G73410 Length:243 Species:Arabidopsis thaliana


Alignment Length:145 Identity:59/145 - (40%)
Similarity:77/145 - (53%) Gaps:6/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 KGPWTRDEDDMVIKLVRNFGPKKWTLIARYLNGRIGKQCRERWHNHLNPNIKKTAWTEKEDEIIY 200
            :|.|...||:.:..||..:||..|..||..|.||.||.||.||.|.|:|.|.:..:||:|:|.:.
plant     6 RGHWRPAEDEKLKDLVEQYGPHNWNAIALKLPGRSGKSCRLRWFNQLDPRINRNPFTEEEEERLL 70

  Fly   201 QAHLELGNQWAKIAKRLPGRTDNAIKNHWNSTMRRKYDVERRSVNASGSDLKSSRTHLITLIKSG 265
            .||...||:|:.||:..|||||||:||||:..|      .||:...|...|..|.|...:|:.|.
plant    71 AAHRIHGNRWSIIARLFPGRTDNAVKNHWHVIM------ARRTRQTSKPRLLPSTTSSSSLMASE 129

  Fly   266 GISKCMNNMQHNKES 280
            .|........||..|
plant   130 QIMMSSGGYNHNYSS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MybNP_511170.1 SANT 85..132 CDD:197842
Myb_DNA-bind_6 88..147 CDD:290632 4/10 (40%)
SANT 136..184 CDD:197842 22/47 (47%)
Myb_DNA-bind_6 139..197 CDD:290632 26/57 (46%)
SANT 188..235 CDD:197842 23/46 (50%)
Myb_DNA-binding 188..233 CDD:278669 22/44 (50%)
Cmyb_C 388..530 CDD:286408
MYB54NP_177484.1 PLN03091 6..>113 CDD:215570 50/112 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45614
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.